KEGG   Yarrowia lipolytica: YALI0F01584gHelp
Entry
YALI0F01584g      CDS       T01033                                 

Definition
(RefSeq) YALI0F01584p
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00010  Glycolysis / Gluconeogenesis
yli00051  Fructose and mannose metabolism
yli00562  Inositol phosphate metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
yli01230  Biosynthesis of amino acids
Module
yli_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
yli_M00002  Glycolysis, core module involving three-carbon compounds
yli_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0F01584g
   00051 Fructose and mannose metabolism
    YALI0F01584g
   00562 Inositol phosphate metabolism
    YALI0F01584g
Enzymes [BR:yli01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     YALI0F01584g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   YALI0F01584g
  Exosomal proteins of bladder cancer cells
   YALI0F01584g
  Exosomal proteins of melanoma cells
   YALI0F01584g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 2908058
NCBI-ProteinID: XP_504867
UniProt: Q6C395
Position
F:complement(247294..248133)
Genome map
AA seq 279 aa AA seqDB search
MSNTRQPVVAISLKMYFDPAKTLQFVSALAGIEQPDAELEKHGITGPVQDSSSTVATAAL
NHVELVVMPDFLSIRECTRLKNRLDEPLFNVGAQDCWQADEGAFTGEVSPKHLAQLGVRY
VEIGHAERRKQFGETNEWVINKSAACSRNSIIPWICIGEINKGDIEACGDEVWEQIKPVL
DNCTGQLVFAYEPVWAIGAPKPAESDHIIGVVSYLRKKIDAEKETNNNDVRIVYGGSAGP
GLVESLNGVVDGLFLGRFGHNPDNVKKVVEEVGAVASKR
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacacgacagcccgtggtggccatctcgctcaaaatgtactttgatccggcc
aagacgctgcagtttgtctctgccttggctggaattgaacagcccgacgctgagcttgag
aagcacggaatcactggacccgtccaggactcatccagcaccgtggccactgccgccctc
aaccacgtcgagcttgtggtcatgcctgacttcctgtcgatccgggaatgcactcggctc
aagaaccgtctggacgagcctctgttcaacgtcggagcccaggactgctggcaggccgac
gagggagccttcaccggagaagtgtcgcccaagcatttggcccaattgggtgtgcgttac
gtggaaattggccacgctgagcgacgaaagcagtttggagaaaccaacgagtgggtcatc
aacaagtccgccgcctgctcccgaaacagcatcattccctggatctgcattggcgaaatc
aacaagggagacatcgaagcctgcggagacgaggtctgggagcagatcaaacctgttctg
gataactgcaccggccagctggtctttgcttacgagcctgtgtgggccattggagctccc
aagcccgctgagtcggatcatatcattggagttgtctcgtatctgagaaagaagattgac
gccgagaaagagaccaacaacaacgacgtgcgaatcgtctacggtggttctgctggcccc
ggactggttgagtctctcaacggagtagtggacggcctgttcctcggccgattcggacac
aaccccgacaacgtcaagaaggtggtcgaggaggttggagctgtagccagcaagagataa

DBGET integrated database retrieval system