KEGG   Yarrowia lipolytica: YALI0F03993gHelp
Entry
YALI0F03993g      CDS       T01033                                 

Definition
YALI0F03993p
Orthology
K10739  
replication factor A2
Organism
yli  Yarrowia lipolytica
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    YALI0F03993g
   03420 Nucleotide excision repair
    YALI0F03993g
   03430 Mismatch repair
    YALI0F03993g
   03440 Homologous recombination
    YALI0F03993g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:join(597511..597514,597931..598643)
Genome map
AA seq 238 aa AA seqDB search
MDYDGGFTFDSQGGSQKPANSGSVIPVTLKQLNDAFNNSPPAGALQIDGVPSQHVALCGK
IILLESKPSFFMLTVDDGTGSTDVRLFRKGTEDDENSELTVKEGDYISCVAALKSFNNKW
MVNSSGVAAVTDFNHVIFHQMQSLQTHLKATGAKPSGGADGVKSESKSGADLFVADNSND
ALFEIVRELTVMCPDGVPTEQIASVAKMSVDESRDKLQELITEGRVMECMDNHYMCIA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggattacgacggaggcttcactttcgactcccagggcggctcacaaaagcccgccaac
agcggcagcgtcatccccgtgacgctcaaacagctcaacgacgcgttcaacaactcgcca
ccggccggcgcgttgcagattgacggcgtcccatcgcagcacgtggccctatgcggcaag
attatcctgctcgaaagcaagccatccttcttcatgctgacggtcgacgacggcaccggg
tccacggacgtgcggttgttccgaaaaggcaccgaggacgacgagaacagcgagctaacc
gtcaaggagggcgactacatctcctgcgtcgcggcgctcaagtcgttcaacaacaaatgg
atggtcaactcgtccggggtggcggccgtgacggacttcaaccacgtcattttccaccag
atgcagtcgctgcagacccacctcaaggccaccggcgccaagcccagtggcggggccgac
ggcgtcaagagcgagtccaagtccggcgccgatctctttgtcgccgacaacagcaatgac
gcgctgtttgagattgtacgcgaactgacggtcatgtgtcctgacggcgtccccaccgag
cagattgcttctgtggccaagatgtcggtggacgagtcgcgggacaagttgcaggagctc
atcaccgagggacgcgtcatggagtgtatggacaatcactacatgtgtattgcatag

DBGET integrated database retrieval system