KEGG   Yarrowia lipolytica: YALI0F05214gHelp
Entry
YALI0F05214g      CDS       T01033                                 

Definition
YALI0F05214p
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:yli01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:yli01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:yli00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:yli00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:yli00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(join(783915..784655,784732..784734))
Genome map
AA seq 247 aa AA seqDB search
MSRTFFVGGNFKMNGSLESIKAIVERLNASELDPKTEVVISPPFPYLLLAKESLKKPTVS
VAGQNSFDKGDGAFTGEVSVAQLKDVGAKWVILGHSERRTINKESSEWIADKTKYALDNG
LDVILCIGETIDEKKAGKTLDVVRSQLDPVIAKIKDWSNVVIAYEPVWAIGTGLAATAED
AQQIHHEIRAYLKDKIGAQADKVRIIYGGSVNGKNSGTFKDKSDVDGFLVGGASLKPEFV
DIINSRL
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgaaccttttttgttggcggaaacttcaagatgaacggctctctggagtccatc
aaggccattgttgagcgactcaacgcctccgagctcgaccccaagaccgaggtggtcatc
tcgccccccttcccctacctcctgctcgccaaggagtctctgaagaagcccaccgtgtct
gtggctggccagaactctttcgacaagggagacggtgccttcaccggtgaggtgtctgtg
gcccagctcaaggacgttggagccaagtgggtcattctcggccactccgagcgacgaacc
atcaacaaggagtcctccgagtggattgccgacaagaccaagtacgctcttgacaacggt
ctcgacgtcatcctctgtatcggagagaccattgacgagaagaaggctggcaagaccctg
gacgttgtccgatcccagctcgaccccgtcatcgccaagatcaaggactggtccaacgtg
gtcattgcctacgagcccgtctgggccatcggtaccggtctcgctgccaccgccgaggac
gcccagcagatccaccacgagatccgagcctacctcaaggacaagattggcgcccaggcc
gacaaggtccgaatcatctacggtggttccgtcaacggcaagaactctggtaccttcaag
gacaagtctgatgtcgacggtttcctcgtcggtggtgcttctctcaagcccgagtttgtt
gacatcatcaactctcgactttaa

DBGET integrated database retrieval system