KEGG   Yarrowia lipolytica: YALI0F05962gHelp
Entry
YALI0F05962g      CDS       T01033                                 

Definition
(RefSeq) acetate--CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00010  Glycolysis / Gluconeogenesis
yli00620  Pyruvate metabolism
yli00640  Propanoate metabolism
yli00680  Methane metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01130  Biosynthesis of antibiotics
yli01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YALI0F05962g
   00620 Pyruvate metabolism
    YALI0F05962g
   00640 Propanoate metabolism
    YALI0F05962g
  Energy metabolism
   00680 Methane metabolism
    YALI0F05962g
Enzymes [BR:yli01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     YALI0F05962g
Lipid biosynthesis proteins [BR:yli01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   YALI0F05962g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 2908441
NCBI-ProteinID: XP_505057
UniProt: Q6C2Q5
Position
F:complement(882439..884412)
Genome map
AA seq 657 aa AA seqDB search
MSEDHPAIHPPSEFKDNHPHFGGPHLDCLQDYHQLHKESIEDPKAFWKKMANELISWSTP
FETVRSGGFEHGDVAWFPEGQLNASYNCVDRHAFANPDKPAIIFEADEPGQGRIVTYGEL
LRQVSQVAATLRSFGVQKGDTVAVYLPMIPEAIVTLLAITRIGAVHSVIFAGFSSGSLRD
RINDAKSKVVVTTDASMRGGKTIDTKKIVDEALRDCPSVTHTLVFRRAGVENLAWTEGRD
FWWHEEVVKHRPYLAPVPVASEDPIFLLYTSGSTGTPKGLAHATGGYLLGAALTAKYVFD
IHGDDKLFTAGDVGWITGHTYVLYGPLMLGATTVVFEGTPAYPSFSRYWDIVDDHKITHF
YVAPTALRLLKRAGTHHIKHDLSSLRTLGSVGEPIAPDVWQWYNDNIGRGKAHICDTYWQ
TETGSHIIAPMAGVTPTKPGSASLPVFGIDPVIIDPVSGEELKGNNVEGVLALRSPWPSM
ARTVWNTHERYMETYLRPYPGYYFTGDGAARDNDGFYWIRGRVDDVVNVSGHRLSTAEIE
AALIEHAQVSESAVVGVHDDLTGQAVNAFVALKNPVEDVDALRKELVVQVRKTIGPFAAP
KNVIIVDDLPKTRSGKIMRRILRKVLAGEEDQLGDISTLANPDVVQTIIEVVHSLKK
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagaccacccagccatccacccaccctccgagttcaaggacaaccacccccac
ttcggaggcccccacctcgactgtctgcaggactaccaccagctgcacaaggagtccatt
gaggaccccaaggccttctggaagaagatggccaacgagctcatctcctggtcaaccccc
tttgaaactgtgcgatctggcggcttcgagcacggcgacgtggcctggttccccgagggc
cagctcaacgcctcctacaactgtgtggatcgacacgcctttgccaaccccgacaagccc
gccatcatttttgaggccgatgagccgggccagggccgaatcgtcacctacggcgaactg
ctgcgacaggtgtctcaggtcgcagccaccctgcgatccttcggcgtccagaagggcgat
actgtggccgtctacctgcccatgatccccgaggccattgtcactctgctggccatcacc
cgaattggcgctgtccactcggtcatcttcgccggcttctcctccggttctctgcgagac
cgaatcaacgacgccaagtccaaggttgtcgtcaccaccgacgcctccatgcgaggaggc
aagaccatcgacaccaagaagattgtcgatgaagccttgcgagactgcccctctgttacc
cacaccctggtcttccgacgagcaggtgtcgagaacctggcctggactgagggccgggac
ttctggtggcacgaggaggtcgtcaagcaccgaccctaccttgcccccgtccccgttgcc
tccgaggaccccatcttcctgctttacacctctggatccaccggcacccccaagggtctg
gcccacgctaccggtggctacctgcttggtgctgccctgaccgccaagtacgtgtttgac
atccacggagacgacaagctgttcaccgctggagacgttggctggatcaccggccacacc
tacgtgctctacggtcctctgatgctcggagccaccactgttgtgttcgagggaacccct
gcctacccctccttctcgcgatactgggacattgtcgacgaccacaagatcacccacttc
tacgtggctcccaccgccctgcgtctcctgaagcgggccggcacccatcacattaagcac
gacctgtcgtctctgcgaaccctcggctctgtgggtgagcccattgcccccgacgtgtgg
cagtggtacaacgacaacattggccgaggcaaggcccacatctgtgacacctactggcag
accgagactggctcgcatatcattgcccccatggccggcgtgacccccaccaagcccggt
tctgcttccctgcctgtctttggaattgatcccgttatcattgatcccgtgtctggcgag
gagctcaagggtaacaacgttgagggtgttcttgccctgcgatctccctggccctccatg
gcccgaaccgtgtggaacacccacgagcgatacatggagacctacctgcggccctacccc
ggctactacttcaccggtgatggtgctgcccgagacaatgacggcttttactggatccga
ggccgagtcgacgacgttgtcaacgtttctggccaccgtctttccaccgccgagattgag
gctgctctcattgagcacgctcaggtgtctgagtctgccgttgttggtgtccatgacgat
ctgactggccaggccgtcaacgcctttgtggctctcaagaaccccgtcgaggatgtggac
gctctgcgaaaggagcttgttgtgcaggtgcgaaagaccattggaccctttgctgctccc
aagaatgtcatcatcgtggacgatctgcccaagactcggtctggcaagatcatgcgacga
attctgcgaaaggtgcttgctggcgaggaggaccagctcggagacatttccactcttgct
aaccccgacgttgtccagaccatcattgaggttgttcactcgttgaaaaagtaa

DBGET integrated database retrieval system