KEGG   Yarrowia lipolytica: YALI0F06424gHelp
Entry
YALI0F06424g      CDS       T01033                                 

Definition
YALI0F06424p
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
yli  Yarrowia lipolytica
Pathway
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:yli00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(952894..954183)
Genome map
AA seq 429 aa AA seqDB search
MSQPSSPSQPTRRRSSMGTIALGDNSGPALATMPENVQQARASKARQRAISNTSLDDRKA
PAGTSSSAVVDQDDKPLGPLAYLWTSYREYSYQNTWLNPLLTMLVVVGAYYAQGNPGPQN
PLHRFIFPSYKLAPHTELNPTDDYMYGKGKRDFTFVGFYMIFFTFFREFVMQMFLKPFAT
FCGVTKKGKVNRFMEQTYSIIYYSLAGSFGLYIMYQTPIWFFNTTAFYENFPHKTHIAMF
KVYYLLQAAFWGQQSVILCMQLEKPRKDFKELVFHHIVTIALIWCSYRFHFTWMGLCVYV
TMDVSDVFLAVSKTLNYVDHAITGPFFLVFMGVWVYTRHYLNLKILYSILTEFATVGPFE
LNWVTQQYKCTLSQRITFCLLAALQLVNAYWCFLIFRIAYRFIFHDIQKDERSDDEDEDE
DEDESKKDK
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgtcacagccatcttctccatctcaacccacacgcagacgatcgtccatgggcaccatt
gcgctaggagacaactcgggcccggccctggccaccatgcccgaaaacgtgcagcaagcc
cgggcctccaaggcccgtcaacgagccatttccaacacgtcgttggacgaccgaaaggcc
cctgccggaacctcctcttcggccgttgtcgaccaagatgacaagccactcggtcccctg
gcctacctgtggacctcgtatcgagagtattcgtaccagaacacctggctcaaccctctg
ctgaccatgctggtggtggtgggagcttactacgcccagggcaaccccggaccgcaaaac
ccgctgcatcgattcatcttcccctcctacaagctggcgccccacacggagctcaatccc
accgacgactacatgtacggcaagggcaaacgggacttcacctttgtgggtttctacatg
atcttcttcacctttttccgagagtttgtgatgcaaatgttcctcaagccgtttgcaacc
ttctgcggcgtcaccaagaagggcaaggtcaaccggttcatggaacagacctactccatc
atttactactcgctggcgggctcctttggcctctacatcatgtaccagactcccatctgg
ttcttcaacaccaccgccttttacgagaactttccccacaagacccacattgccatgttc
aaggtctactacctgctgcaggctgccttctggggccagcagagcgtgattctgtgcatg
cagctggagaagccccgaaaggacttcaaggagctcgtgttccaccacattgtcaccatt
gctctcatctggtgctcgtaccgattccacttcacctggatgggtctgtgtgtctacgtg
accatggacgtgtctgacgtgttccttgccgtctccaagaccctcaactacgtggatcat
gccatcaccggtcccttcttcttggtcttcatgggcgtctgggtctacacccgtcactac
ctcaacctcaagatcctctactccattctcaccgagtttgccaccgtcggtccctttgag
ctcaactgggtcacccagcagtacaagtgcacgctgtcgcagcgaatcaccttctgtctt
ctggcggctctgcagcttgtcaacgcctactggtgctttttgatcttccgaatcgcctac
cggttcattttccacgacatccagaaggacgagcggtccgacgatgaggacgaggacgag
gacgaggatgagtccaagaaggataaataa

DBGET integrated database retrieval system