KEGG   Yarrowia lipolytica: YALI0F07084gHelp
Entry
YALI0F07084g      CDS       T01033                                 

Definition
YALI0F07084p
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:join(1038409..1038458,1039056..1045956)
Genome map
AA seq 2316 aa AA seqDB search
MSDASVLNSIFQQLRTARTLTEKTHAAEELRDHLTSVTHELNTEPLSRYNNDINLRISEL
IHNGDPVIRLGGIMAIDRLIDVDVGEENAIKVTRFTNYLKTTIPGDTESMRIAVDALGRL
AATGGNLSATVVESEVNRALEWLQSDRGEGSRRHAAVMVIKSMAQHCATLLYGYMSQILD
LIWVGLRDPKVQIRVDSAEALQYCLNIVHSRDQTLKKQWFNRIMEEAKVSLNMGGVDTIH
GALLTYKEVLRGGMFENSRYDEVCEVVLANRDSRDVLIRKTVLNIIPDLAQYNPWQFTKR
YLHKCMLYLLSQLKKDKDRNLVFLSIGQISFSVRSAMAPYLDAILENIREGLSLKSRYRK
EQESAIFSCIGMLAVAVGQALAKHLNQKILDLIMACGLSEHLHNCLSELVHNIPPLGPSI
QQRLLNIISFTLSGHPFKLPGSPAATSSAEYMSVTRAREYRETEDDKDDAAVVALALHIL
GTFNFKGLSLTEFVRFCAITYVDHDSPEVRKAAALSSCTIYLNDPIVFQFSAHALSAVSE
VVEKLLTVAVVDPDPDIRIGILTTFDPRIDPHLSQAENVRLLFTALNDEVFAIRQLSIGI
IGRLTKINPAYVVPHLRKTLIHLLTELEYAKFGRTKEESARLLAQLIGSTHGLIKPYVKP
IIKVLLARARDTSSNVASAVITAIGELAATGREGMIEYIPEIMPIFLETFSDQNAQKKLA
GLKSLGQLSSSSGYVIQPLLDYPQLLTLLTNTLKSDNVDTRRETVRLMGILGALDPYKHR
EVERSTQDDSAEYDSIPTDVALLIQGMSPSSDEYNHTVVITTLMAILKDQSLVSHHNAVV
QAIVIIFKSLGLKCVPFLNQIIPGWLQVLRSSTPSMAEFFVQQLALLVLIVKQHIRSYLD
DIFAVVQELFAIPSMQPVVLTLVENIARSLSGEFKLHVPTLLPLLLGVLENDKSTTKLTS
IKVLQTFVVLGANIEDYIHLIIPIIVRMFEYSTHQLKKRAIQTIGQLSRTVDLTDMSSRI
VHPLLRVLAACPVTEEPNSHHDELRRTVMETLSSLCFQLGSDYTIFIPLVNKAMLKAGVN
SPSYDQLVNRLLSGEPLPASMDPDSRIQELNNTPPDTTSLNKLPVNQQHLKTAWDTAQCS
TKEDWQEWMRRLSTAFLRESSSHALRACGVIANNYQPLAKDLFNPSFYSCWSELYDQYKD
DLVNHIETALMAPNMPPETLQILLNLAEYMEHDDKPLPIDMRTLAAYAHRCHAYAKALHY
KELEFMREPTTPIIENLIAINNSLQQSDAAIGILKHVQQHHQWQLKESWYEKLQRWDDAL
EAYDKLDDNSMEVTMGKMRCLHALGEWESLAEIAQEKWTSSGPEVRRVVAPLAAAASWGL
SQWERMDTYISVMKVDSADKSFFNAVVSIHRNNFDEAHTHITRARDLLATELTALISESY
NRAYGVVVRFQMLAELEEIIVYKGLGRNSEEQAAMRATWMKRLKGCQRNVEDWQRMLKVR
SLVVKPKQDMEMWIKFANLCRKSGRLSLAEKSLNALLDPDDPDSQTSRAPPPVVYAQLKY
MWATGNWEDALNHLVDFTNRMSLDLGLDPEDLITQKLPSEGAAVPKKIQDYTRLLARCFL
KQGEWQISLQDDWKEKNPDSILGSFLLATHFDAKWYKAWHNWALANFQVVSLRYSEKEEL
ALEDVSQYVVPAIKGFFHSISLSNGSSLQDTLRLLTLWFRYGHVSDASQALYDGFQMLSI
DTWLDVIPQLISQIHQRSQVVSKALQGLLIELGKNHPQALLYLLNVAVKSDSLSRQQAAM
NVIDKMRTHNPILVEQAELVSKELIRVAVLWHEQWHEGLEDASRFFFGERNIEKMFQTLE
PLHAMLERGPETLREVSFQTAFGRDLHDANEWVWSFKRTNDPAHLNQAWDIYYNVFRRIA
KQLPQLISLDLQYVSPKLLAAENLELAVPGSYAPGKEIVRIMKFDPIFTVISSKQRPRRL
SCKGSDGKDYVYALKGHEDIRQDNLVMQLFGLVNTLLSQDSECFKRHLNITKYPAIPLSP
KSGLLGWVPHSDTLHTLIKEYRDGRILINVEHRFMLQMAPDYDPLTHLQKIEVFTYALDN
TKGQDLYRVLWLKSRSSEAWLERRSQYTRSLATMSMVGYILGLGDRHPSNLMLDRYTGKV
IHIDFGDCFEAAILREKYPETVPFRLTRMLTYAMEVSGIEGSYRITSEHVMRVIRDNKES
LLAILEAFAYDPLINWGFELPRGEDLPVKRFDEDEKVNVRMARAHLVLKRIQDKLSGNDI
KNRKNVDVPAQVDYLIQQATSIENLCQHFIGWCSFW
NT seq 6951 nt NT seq  +upstreamnt  +downstreamnt
atgtccgacgcgagcgttttgaatagcatcttccagcagttgcggacagcccgcacactg
actgaaaaaacacacgctgcagaagaactgcgcgaccatctaacctccgtcacgcacgaa
ctcaacacagagcctctctcgcgctacaacaacgacatcaaccttcgcatttccgagcta
atccacaatggcgaccccgtcatccggctgggcggtatcatggccattgaccggctcatt
gacgtcgatgtcggcgaggaaaacgccataaaagtgacccggttcaccaactacctgaag
acgactattccaggagatacagaatcgatgcgcattgccgtcgacgctctcggccgtcta
gctgccacgggaggcaatttgtctgccactgtggttgaatccgaggtcaacagagctctc
gaatggctccagagcgaccgaggagagggctctagacgccatgctgccgtcatggtgatc
aagagtatggcccagcattgtgccacgttgctgtacgggtacatgagccagatccttgac
ctgatctgggtgggactgcgtgatccgaaggtgcagattcgggttgactcggccgaggcg
ctgcagtactgcctgaacattgtgcattctcgtgaccagacccttaaaaagcagtggttc
aaccgaattatggaggaggccaaggtgagtttgaacatgggtggtgtcgacaccattcat
ggcgctctgctcacctacaaggaagtccttcgaggaggcatgtttgagaactcacgatac
gacgaggtgtgtgaggttgtgttagccaaccgcgactcgcgtgacgtgctgatccgaaag
acggtgctcaacatcatcccagaccttgcccaatacaatccctggcagtttacaaagcgg
tatctgcacaaatgcatgttgtaccttctttcacagctcaagaaggacaaggaccgtaac
cttgtttttctgtcgattggccagatttccttttctgtccggtcggccatggctccttac
ttggacgccattctggaaaatatccgagaaggtctcagtctgaaatctcgatataggaag
gagcaggagagtgccattttctcctgtattggcatgttggctgttgctgtgggtcaggct
ctggccaagcatctgaaccaaaaaattctggatctcatcatggcttgtggtttgagtgaa
cacctgcacaattgtctgagtgagctggttcacaacattcctccactgggcccttccatc
cagcagcggttgttgaacatcatctcgttcactctctctggccacccctttaagctccct
gggtctcctgctgcgacttcttctgcagagtacatgtctgtgacacgtgcacgggagtac
cgagagactgaggacgacaaggatgatgcagccgtggttgcgcttgctcttcacattctc
ggcacgtttaacttcaagggtttgtcgctgaccgagtttgtgcggttctgtgcaatcact
tatgttgatcatgactctcctgaggtgcgaaaagcagccgccctctcatcttgcaccatt
tatctcaacgaccctattgtgttccagttctccgctcatgctctgagtgccgtttccgaa
gtggttgagaagctgttgacggtggctgtggttgatcctgaccctgatatccgaattggt
attctcactacatttgatccgcgaattgaccctcatttgtcccaggccgagaacgtgcgt
cttttattcactgctttgaacgacgaggtttttgcgattagacagctgtccattggcatt
atcggtcggctgacaaagataaaccctgcttacgttgttcctcatctgagaaaaacgttg
attcatcttctgaccgaactggagtatgccaagtttggacgtaccaaggaagagagtgcg
cggctgcttgcacagctgattgggtcgacgcacggactcatcaagccgtacgtcaaaccc
atcatcaaggtgctgcttgctcgtgcacgtgacacgtcttccaacgtggcctccgcggtt
atcactgctatcggagagctagctgccactggacgggaaggcatgattgagtacattccc
gagattatgcctattttcttggaaactttttcggatcagaatgctcagaagaagctggct
ggtctgaaatctctcggacagctctcttcctcttccggatacgttattcagccgctgctg
gattacccccagctgctcacactgcttactaacactctcaagagcgacaatgttgatact
cgtcgagaaactgtccgtctcatgggtattcttggagctctggatccttataagcatcga
gaggtggagagaagtacccaggatgattcagcagagtatgactcgatccccacagatgtg
gctcttctcatccagggcatgtctccctcttcggacgagtacaaccacactgtcgtgatt
acaactctaatggcgattctcaaggaccagtcgcttgtatcgcaccacaatgctgttgtc
caagccattgtcatcattttcaagtcgctgggtctcaagtgtgtgccgtttttgaatcag
attatccctggctggctgcaagtgcttcgaagcagtactccttctatggccgagtttttt
gtccagcagttggctcttctggttctcattgtcaagcagcacattaggtcgtatcttgac
gacatttttgctgttgttcaggagctctttgccattccatccatgcagcctgttgtcctg
acgctggttgaaaacattgctcggtctctgagtggcgagttcaagctgcatgtgcctact
ctcttgcctctgcttcttggcgtgctggagaacgacaaaagcaccaccaagctcacctcc
atcaaggtgctgcagacgttcgtggtgctgggcgccaacattgaggactacattcacctc
atcatccccatcattgtgcgaatgttcgaatactcgactcatcagctcaagaaacgggcc
attcagactattggacagttgtctcgaactgtggatctcaccgacatgtcgtcgcgaatc
gtgcatcctctgttgcgtgtactggcagcctgtcctgtgactgaagagcccaattcgcac
catgatgagttgcggcgaaccgtcatggagactctgtcatcgctgtgtttccagctgggt
tccgattacaccattttcatcccccttgtgaacaaggctatgctcaaggccggagtgaac
tctccctcctacgaccagctggtcaaccgactcctctctggagaaccactgcctgcgtcc
atggaccccgacagtcgaatccaggagctcaacaatactcctccggataccacctcgctc
aacaagctgcctgtgaaccaacagcacttgaagaccgcgtgggacactgcgcaatgctcg
actaaggaggattggcaggagtggatgcgacgtctctcgactgctttcctgcgcgagtct
tcttctcacgccctgcgagcctgtggtgtcattgctaacaactatcagccattggccaag
gacctgttcaatccgtccttctactcgtgctggtctgagctctacgaccagtacaaggac
gacttggtgaaccacattgagacggctctgatggcgcccaacatgccgcccgagacgctg
cagatcctgctaaacctggccgagtacatggagcacgacgacaagccgctaccgatcgat
atgcgtactctggctgcctatgctcaccgctgccatgcctacgccaaggcgctgcactac
aaggagctggagtttatgcgggagcctacgacgcccatcattgagaatctgatcgctatc
aacaactcgttgcagcagagcgacgctgctatcggtattctcaagcacgtgcagcagcat
catcagtggcagctcaaggaatcgtggtacgagaagctgcagcggtgggacgatgctctc
gaggcctacgacaagcttgatgacaattccatggaggtcacaatgggtaagatgcgatgt
ctgcatgcccttggtgagtgggagtcgctggccgagattgcacaggagaaatggacttca
tcaggccccgaggtgcgacgagtggtggcacccctggctgccgcagcttcctggggtttg
tctcagtgggagcgaatggacacatatattagtgtcatgaaggtggactctgccgacaag
tccttcttcaacgctgtggtgagcatccacagaaacaactttgatgaggcccatacgcat
atcactcgtgcacgtgacttgctggctaccgagctcaccgctctcatttctgagtcgtac
aaccgagcctatggtgttgttgtgcggttccagatgctggcagagctggaggagattatc
gtctacaagggtctgggtcgcaactccgaggagcaggctgccatgcgggccacgtggatg
aagcggctcaagggctgtcagcgaaacgtagaggactggcagcgaatgctcaaggtgcgg
tctctggttgtcaagccgaaacaggatatggagatgtggatcaagtttgcaaacctgtgt
cgaaagagtggtcggctctctttggctgaaaagtcgctcaatgctcttcttgaccccgat
gatcccgactcacagacttccagagctcctccacctgttgtttacgcccagctcaagtac
atgtgggctactggcaactgggaagatgccctgaatcacctcgttgactttaccaatcga
atgtcgctcgatctgggcctggatcctgaagatctcatcactcagaaactaccctcagaa
ggcgctgctgtccctaagaagattcaggactacactcgtcttcttgctcgatgtttcctc
aagcagggcgagtggcagatttcgttgcaggacgactggaaggagaagaaccccgattct
atcctcggctcgttcctgttggccactcattttgacgccaaatggtacaaggcgtggcac
aactgggcgctggcaaacttccaggttgtgtctctgcggtactcggaaaaggaggagttg
gccctggaagacgtgtctcaatatgtggtacctgccatcaagggtttcttccattccatc
tccttgtccaatggatcttctctgcaagacactcttcgtcttctgaccctgtggttccgg
tacggccatgtgtctgacgcgtctcaggccctttatgacggattccagatgctttctatt
gacacgtggctggatgtcattcctcagctcatttctcagattcaccagcggtctcaggtt
gtttccaaggctctgcagggtcttctgattgagctcggtaagaaccatccccaggctctg
ctgtacctgctcaacgtggctgtcaagagtgactctctgtcgcgtcaacaggccgctatg
aacgttattgacaaaatgagaactcacaaccccatcctagtcgagcaggctgagctggtg
tccaaggagctcattcgagtggctgttttgtggcacgagcaatggcacgagggtctggaa
gatgcgtcgcgattcttctttggcgagcgaaacattgaaaagatgttccagacgctagag
cctctacacgcaatgctggagcggggtcccgaaactctgcgagaagtgtccttccaaaca
gcttttggacgtgacttgcacgatgccaacgagtgggtgtggagttttaagcgaaccaat
gaccctgcccacctcaaccaggcctgggacatttactacaatgttttccgacgaatcgcc
aagcagttgccccagctcatctcgcttgacctgcagtacgtgtctcccaagctgctggca
gccgagaatctcgagctggcggtgcctggttcgtacgctccgggcaaggagattgtgcga
atcatgaagttcgacccaattttcaccgttatctcgtccaagcagcggcccagacggctg
tcgtgcaagggcagtgatggtaaggactacgtgtacgctctcaagggccacgaggatatc
agacaggataacctggtgatgcaattgtttggactggtgaacactctgctatctcaggac
tcggagtgtttcaagcgacatctcaacattacaaagtaccctgccattcctctgtccccc
aagtctggtctcctcggctgggtgcctcattcggacactctgcatacactcatcaaggaa
taccgggatggccgaatcctcatcaacgtggagcatagattcatgctgcagatggcgccg
gactacgatccattgacgcatctgcaaaagattgaggtgtttacgtacgctctggacaac
actaagggccaggatctgtaccgagtcttgtggctcaagtcgcggtcctcggaagcttgg
ttggagcgacgatctcaatacacacgatccttggctacgatgtccatggttggctacatt
ctcggacttggagatcgacatccctccaacctgatgctggaccgatacactggtaaggtg
attcacattgatttcggtgactgtttcgaggctgccattctgcgagaaaagtaccccgaa
acagtgcccttccgactgactcgaatgctcacatacgccatggaggtgtcaggaatcgag
ggctcgtaccgaatcacgtccgagcatgtgatgcgggtcatccgagacaacaaggagtcg
ctgctggccattctggaagcctttgcctatgatcctctcatcaactggggtttcgagctt
cccagaggcgaggatctgcctgtcaagcggttcgatgaggacgaaaaggtcaatgttcga
atggctcgagcgcacttggtcctcaaacgaatccaggacaagctgtctggaaacgacatc
aagaacagaaaaaatgtcgatgtgccggcacaggtggactacttgattcagcaggccact
agcattgagaatctgtgtcagcacttcataggttggtgttctttctggtag

DBGET integrated database retrieval system