KEGG   Yarrowia lipolytica: YALI0F07557gHelp
Entry
YALI0F07557g      CDS       T01033                                 

Definition
YALI0F07557p
Orthology
K08866  
serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
yli  Yarrowia lipolytica
Pathway
Cell cycle - yeast
Brite
KEGG Orthology (KO) [BR:yli00001]
 Cellular Processes
  Cell growth and death
   04111 Cell cycle - yeast
    YALI0F07557g
Enzymes [BR:yli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     YALI0F07557g
Protein kinases [BR:yli01001]
 Serine/threonine protein kinases: Other group
  TTK family
   YALI0F07557g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:1089886..1092057
Genome map
AA seq 723 aa AA seqDB search
MTSYAPSRIEVDEDDTNNPSMPPILSDYARELLAEKMRSTSGPPSAHNTSVPGRLRSYGR
EIRDPRELSSSSRRAPITTTPARAHHMAAASTTQDDIMDSDSPERPSPYSPQTPGVGLRT
KTTHATSTAPNNHNNGHTQTTRVRRIGRGLGPPKRAPPPSEGGVPVPVGDEMVVEEVISN
ETGDLSPQMNRLRFSENHHGNGVSPNRSGLVRSDRSARSDRSMADRSGSSGMGGYKSSPL
SGPRLHERQVLAPVSPNTLPPPRMDKLMHNEEQQWRERMAREEEREREWQRHERERQERE
RQESERLERIERERMEKEHMERVERERMELDRQRARERERERERERDRERERERERERDL
ERERERERDRERDRDRDLDISSVQAYDKRKITINGKQYVRLEKLGRGGSSVVYKVQAAGA
KDVYAVKKVIFDDVDESVIKGFKGEIDLLMRLKHENRVVELMDYEMRSSQVYVVMECGEI
DLAHILNNRLNQPLDISFVRYYATELLKCVDAVHRNGIVHSDLKPANFLLVKGILKIIDF
GIANVVPDYTANVHRDAQMGTPNYMAPEALIETKNSNGVGPRIKIGKPSDIWSCGCIIYQ
MIYGKPPYADFQGMTRIVAIINEKTVVQYPAITPLGNVPVPPAAIEAIKGCLIRESNRRW
TLEQVMDHGFLNPMAVQKDFIKNLLSNAIDYGQAHTEKVRGRELQKLVDSVWMSLSKEEI
NRK
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcttacgcgccctcgaggatagaggtggatgaagacgacacaaacaaccccagc
atgcctccgatcctgagcgactatgcgcgggagctgttggcggaaaagatgcgttccact
tcggggcctccctcagcacacaacaccagtgttcctggcaggctacggagctatggacgt
gaaatacgagatcccagagagctttccagcagctcacgacgtgctccaattaccacgacg
cctgctcgagcgcaccacatggctgctgcttctacgacacaggatgacataatggatagt
gactctccagaacgtccctccccttatagtccccagactccaggcgtggggttgcgaaca
aaaacaacacacgccacgtcaacagcacctaacaaccacaacaacggacacactcaaacg
acccgcgttcgtaggataggacgagggctgggtcctcctaaacgggcccctcctccgtcc
gaaggaggcgtccctgttccagtgggggacgagatggtggtggaggaggttatttccaac
gagaccggtgacctgagtccgcagatgaaccggctgcggttttcggaaaaccaccacggc
aacggtgtcagccccaaccgcagtggtctggttcggtccgacagatctgcgcggtctgac
cggtccatggccgatcgctcggggtcttcgggcatgggaggatataaatcgtcaccgctg
tcggggccacgacttcacgagcgtcaggtactcgctcccgtgtcacctaacacgctgcct
cctcctcgaatggacaagttgatgcataatgaggagcagcagtggcgagagcggatggca
cgcgaggaggaacgggagcgagagtggcagcgtcacgagagagaacgccaggagcgcgaa
cggcaagaatcggagcggctcgaacgcatcgaaagagaacgcatggaaaaggagcacatg
gagagagtggagcgggagagaatggaactcgatcgacaacgagcacgggaacgagagcgg
gaacgggaaagggagcgcgatcgagaacgcgagcgggaacgagagagggaacgggatctc
gagcgggaacgagaacgtgaacgagatagagaacgagacagagatcgcgatctggatatc
tcttctgtccaggcctatgacaaacgcaaaattaccatcaacggcaaacagtatgtgcgg
ttggagaagctcggacgaggaggatcgtctgtggtgtacaaggtgcaggctgcaggagcc
aaggacgtgtacgctgttaagaaggtgatctttgacgatgtcgatgagtcggtcatcaag
ggcttcaagggggagattgatctgttgatgcgtctcaagcacgagaaccgggtggtggaa
ctcatggactacgagatgcggtcttcacaagtctatgttgtgatggagtgcggtgagatt
gatcttgcccatattctcaacaacagactgaaccagcccctcgacatttcatttgtgcga
tactatgccaccgaactgctcaagtgtgtagatgccgtacaccgaaacggcattgtgcat
tccgatctcaagccagccaactttctgcttgtcaaaggcattctcaaaatcattgatttt
ggaatcgcaaatgtcgtccccgactacaccgctaatgtccatcgagacgctcaaatgggc
actcctaactacatggctccggaggctctgattgaaaccaaaaactccaacggggtgggt
cctcgaatcaagattggaaagccatccgacatttggagctgtgggtgcatcatctaccag
atgatctacggcaagcctccgtacgcggatttccagggtatgacacgtattgttgccatc
atcaacgagaagacggtggtgcagtatccggccatcaccccccttggcaatgttcctgtt
cctcctgctgctattgaagccatcaaggggtgtctgattcgagagtcgaaccgacggtgg
acactggagcaggtgatggaccatggttttctcaatcccatggctgtgcagaaggacttc
attaagaacctgctcagtaacgccattgactacggccaggctcataccgagaaggtgcgt
ggtcgggagcttcaaaagctggtggattctgtgtggatgagtctttccaaggaggagatt
aaccgaaagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system