KEGG   Yarrowia lipolytica: YALI0F07623gHelp
Entry
YALI0F07623g      CDS       T01033                                 

Definition
YALI0F07623p
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
yli  Yarrowia lipolytica
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:yli03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(join(1095734..1097056,1097117..1097134))
Genome map
AA seq 446 aa AA seqDB search
MPELGEVAHAASVFAKFATGKKVAEADVQPDKIVFGSETGHEALQKALQGRVITNVSRHG
KYWWLTLDGDADNAVLLHFGMTGYISVKGHRTHYIMMENGGDKKARDRLDRIRGDGGVVE
EKAANGQSIIAANGGDIPEDVSMLEELAEEELEQQTWPPRFVKMDLTLEDGTKLAFYDAR
RLARVKLFTIAEPLDIYKVDPMKKLGPDYSKSPDDEHTPAALKPLDLDAFKAKIQAKKAP
IKSVLLDQSLFSGVGNWVADEILYHSRVHPARMCNLLLESQIDELYTQLVHICQFVVKVE
GNTLLFPLNWLMLNRWGKRNKNKKSYTLEGYEVDHVTVGGRTSSFCPELQHNGPPKEKTT
TKRVKFDGIKTDDEEEQPKELTRTVKEEGEEAEAEETTQTKPKKRRKKVKVEEDLLPLVD
AVEAKDKSILDAQANSRAERAKRRRS
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaactaggagaggtggcgcacgccgcgtcggtgtttgcgaaatttgcaaccggc
aaaaaagtcgccgaggcggatgtccagcccgacaagatcgtctttggtagtgaaaccggc
cacgaggcgctgcagaaggccctccagggccgcgtcatcactaacgtgtcgcgccacggt
aagtactggtggctcacgctcgatggagacgccgataacgccgtattgctacactttggc
atgacgggctacatatccgtcaagggccacagaacgcactacatcatgatggagaacggt
ggcgacaaaaaggcacgtgatcggctcgaccgcatccgtggagatggaggagtcgtcgaa
gaaaaggccgccaacggtcagtccatcattgctgccaatgggggcgacattcccgaagac
gtgtccatgctggaggagctggcggaggaggaactcgaacagcagacgtggccgccgcgg
ttcgtcaagatggatctgacgctcgaggacggtaccaaactcgcgttctacgacgctaga
cggctagctagggtcaagctctttacgatcgccgaacctctcgacatctataaggtggat
ccgatgaagaaactgggtccggattacagcaagagcccagacgacgaacacacaccggcg
gcgctcaaacctctggatctggatgctttcaaggcgaaaatccaggcgaaaaaggcgccc
atcaagtccgtgcttctggaccaatcacttttttcgggcgtaggaaactgggtggccgac
gagattctctaccactcacgcgtgcaccccgctcgcatgtgcaatctgctgctagagtcg
cagatcgacgagctatacacccagctcgtgcacatttgccagtttgtcgtcaaggtggag
ggcaacacgttgctctttccgctcaactggcttatgctgaaccgatggggcaagcggaac
aagaacaaaaagagttacacactggagggctacgaggtggatcacgtgactgtcggaggc
cggacgtcatccttctgtcctgaactacaacataatggacctcccaaagagaagactacc
actaagcgggtaaagtttgatggaatcaagacagacgacgaagaagagcaaccaaaggag
ctcaccaggacggtaaaggaagagggagaggaggccgaggcggaagaaacgacacagacc
aagcccaaaaagcgacgtaagaaggtcaaggtggaggaggacctgctacctctggtggac
gcggtggaggcaaaggacaagtcgatactggatgcccaagcgaatagtcgagctgagcgg
gccaagcgacgacggtcttaa

DBGET integrated database retrieval system