KEGG   Yarrowia lipolytica: YALI0F09251gHelp
Entry
YALI0F09251g      CDS       T01033                                 

Definition
YALI0F09251p
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
yli  Yarrowia lipolytica
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    YALI0F09251g
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    YALI0F09251g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     YALI0F09251g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:1289302..1290237
Genome map
AA seq 311 aa AA seqDB search
MSLVKARYGKDNVRVLKVSRDPSNPKIQQVQELVVKCLLEGDIEVSYTKADNTPIVATDT
VKNTTFIVAKQLPGTWPIELFGAVLADHFIKKYPHISSAHVDIEQYKWTKYDVNGKTSQH
SFVHDGTELRTVHVDRYRDAAKNPETVTTFNIASGIKDLSVLKSTGSMFYGYHKDDFTTL
KPTKDRILSTDVAATWHWISKEIDTLDKIKEIAKKGIFDSVYAQVVDTTLQRFATENSAS
VQATMYNMSTDILDKASLVETVDYELPNKHYFELDLSWHHRLKNTGTDAEVYVPQSNPNG
LIKSSVGRSKL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtccctcgtcaaagcccgatacggaaaggataacgtccgagtgctcaaggtgtcgcga
gacccctccaaccccaagatccagcaggtccaggagctggtggtcaagtgtctgctggaa
ggagacattgaggtttcgtacaccaaggccgacaacacccccattgtcgccaccgacacg
gtcaagaacaccaccttcattgtggccaagcagctgcccggcacctggcccattgagctt
tttggcgctgtgctggccgaccacttcatcaagaagtacccccatatttcgtccgcccac
gtcgacattgagcagtacaagtggaccaagtacgacgtgaacggcaagacatcgcagcac
tcgtttgtgcacgacggcaccgagctgcgaaccgtgcacgtcgaccgatacagagacgcc
gccaagaaccccgaaaccgtcaccaccttcaacattgcctccggtatcaaggatctgtct
gtgctcaagtcgacgggatccatgttctacggctatcacaaggacgactttaccacgctc
aagcccacaaaggaccgaatcctgtccaccgacgtggctgccacctggcactggatctcc
aaggagattgataccctggacaagatcaaggagattgccaagaaaggtatatttgacagt
gtgtatgcccaggttgtcgacaccactttgcagcgatttgccaccgaaaactccgcttcc
gtccaggccaccatgtacaacatgtccaccgacatcctcgataaggcttccctggtggag
acggtggactacgagctccccaacaagcattactttgagctggacctgagctggcatcat
cgtctcaagaacaccggcaccgacgccgaggtgtacgttccccagtccaaccccaacggt
ctcatcaagtcttctgttggccgatcaaagttgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system