KEGG   Yarrowia lipolytica: YALI0F09449gHelp
Entry
YALI0F09449g      CDS       T01033                                 

Definition
YALI0F09449p
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
yli  Yarrowia lipolytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YALI0F09449g
Enzymes [BR:yli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     YALI0F09449g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(1303048..1303779)
Genome map
AA seq 243 aa AA seqDB search
MNILLLKNPTTPRDFYQELFVEQKGHNAVFVPLLQHSPVGIESLKTHIANEVDGIDAVIV
TSHRAVEILGEYASPELLCKPAYTVGPATARCLRELGFKDVRGEETGNGAALVPQLLSDG
YQRFAFYAGKVRRDTIPNKLREAGRSLVEYTVYETVDLDDIAGRFEKAVGALPDAKHNWI
CFFAPSGTAQIVEYLKKNPAHGFKIASIGPTTLDYLQKNDIKVDVTAKQPDPEHFLEAML
SES
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctactgctcaagaaccctacgacgccgcgagatttctaccaggagctgttt
gtcgagcagaagggtcacaatgctgtttttgtgcctcttctgcagcattctccggtcgga
atcgaatctctcaaaacacacattgccaacgaggtggatggtattgacgccgtgattgtc
acctctcaccgcgcagttgaaatcctcggagaatacgccagtccagagctgctctgcaaa
cctgcatacaccgttggtccggctaccgcaaggtgtctccgcgaactgggcttcaaggac
gttcgaggagaagagacgggtaatggagccgctcttgtgccgcaactgttgtcggatgga
taccagcgatttgccttttacgcaggaaaggtgcgacgagacaccatccccaacaagtta
agagaggctggacgaagtctggtggagtacactgtttatgagactgttgatctggacgac
attgctggacggtttgagaaggctgtgggggcgctccccgacgccaagcacaactggatc
tgtttctttgctccctctggcaccgctcagattgtggagtatctcaaaaagaaccctgct
catggcttcaagattgccagtataggacctaccacattggactacctacagaagaatgac
atcaaggtggatgtgacggccaagcaacccgatcccgagcatttcctcgaggctatgctc
agtgagtcgtga

DBGET integrated database retrieval system