KEGG   Yarrowia lipolytica: YALI0F09449gHelp
Entry
YALI0F09449g      CDS       T01033                                 

Definition
YALI0F09449p
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
yli  Yarrowia lipolytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:yli00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(1303048..1303779)
Genome map
AA seq 243 aa AA seqDB search
MNILLLKNPTTPRDFYQELFVEQKGHNAVFVPLLQHSPVGIESLKTHIANEVDGIDAVIV
TSHRAVEILGEYASPELLCKPAYTVGPATARCLRELGFKDVRGEETGNGAALVPQLLSDG
YQRFAFYAGKVRRDTIPNKLREAGRSLVEYTVYETVDLDDIAGRFEKAVGALPDAKHNWI
CFFAPSGTAQIVEYLKKNPAHGFKIASIGPTTLDYLQKNDIKVDVTAKQPDPEHFLEAML
SES
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcctactgctcaagaaccctacgacgccgcgagatttctaccaggagctgttt
gtcgagcagaagggtcacaatgctgtttttgtgcctcttctgcagcattctccggtcgga
atcgaatctctcaaaacacacattgccaacgaggtggatggtattgacgccgtgattgtc
acctctcaccgcgcagttgaaatcctcggagaatacgccagtccagagctgctctgcaaa
cctgcatacaccgttggtccggctaccgcaaggtgtctccgcgaactgggcttcaaggac
gttcgaggagaagagacgggtaatggagccgctcttgtgccgcaactgttgtcggatgga
taccagcgatttgccttttacgcaggaaaggtgcgacgagacaccatccccaacaagtta
agagaggctggacgaagtctggtggagtacactgtttatgagactgttgatctggacgac
attgctggacggtttgagaaggctgtgggggcgctccccgacgccaagcacaactggatc
tgtttctttgctccctctggcaccgctcagattgtggagtatctcaaaaagaaccctgct
catggcttcaagattgccagtataggacctaccacattggactacctacagaagaatgac
atcaaggtggatgtgacggccaagcaacccgatcccgagcatttcctcgaggctatgctc
agtgagtcgtga

DBGET integrated database retrieval system