KEGG   Yarrowia lipolytica: YALI0F14135gHelp
Entry
YALI0F14135g      CDS       T01033                                 

Definition
(RefSeq) YALI0F14135p
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
yli  Yarrowia lipolytica
Pathway
yli00062  Fatty acid elongation
yli01100  Metabolic pathways
yli01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    YALI0F14135g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     YALI0F14135g
Lipid biosynthesis proteins [BR:yli01004]
 Fatty acid synthase
  Component type
   YALI0F14135g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Palm_thioest DUF915
Motif
Other DBs
NCBI-GeneID: 2908579
NCBI-ProteinID: XP_505399
UniProt: Q6C1R3
Position
F:complement(1904757..1905686)
Genome map
AA seq 309 aa AA seqDB search
MKLVTLAIQLSTVLATTPVVLWHGLGDRYDSPGMTGVADQIRDIYPDIYVHSVGLSEDGG
KDQQMGLLGNVREQVESVCDQLAAIPELKGGFNAIGFSQGGLFLRSYAELCPLTNASAPV
LRKLITFGSPHNGIADMPLCGPSDFLCKSRNKLFKSQVWTKNSQTNVVVAQYYRDPNHMD
VYLEKSGFLADINNERQQKNKTYDLSYLEKFVMVMFSEDTTVVPMESAWFQEVDLESGQV
THLEDREIYQEDWIGLKKLGKRGDLEFHTVHGQHMEINDDVIETFALRYLGDDDDIKAGD
DFVFVNQAK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgttactctggcaatccagctatccacagtgctagccactaccccagtggtt
ctctggcatggtctcggcgacagatatgactctccaggaatgaccggtgtggcggaccaa
atccgcgacatttaccctgacatttacgtgcattcagtcggactctctgaagacggcgga
aaagatcagcaaatgggtcttctaggcaacgtaagagagcaagttgagagtgtctgcgac
cagctggcagcaataccagagttgaagggcgggttcaatgccatcggattttcccaagga
ggtctgtttcttcgttcatacgccgagttgtgtcccttgacaaacgcctcagctcctgtt
ctccgaaagctcatcacatttggctcccctcataacggaattgctgatatgccgctctgt
gggcccagcgacttcctttgcaagtctcgtaacaagctgttcaagagtcaggtgtggact
aagaactctcaaacgaatgtggtagtggcacagtattatcgggaccctaaccacatggac
gtgtacctggagaagtctggatttctggcagacatcaacaacgagaggcaacaaaagaac
aagacctacgacctgtcttatttggagaagtttgtcatggtcatgttctcggaggatacc
acagtagtgcctatggagagtgcatggttccaagaggtggatctcgaaagtgggcaagtc
acccaccttgaagacagagagatataccaagaggactggattggacttaagaagcttgga
aagcgtggtgatcttgagttccacacggtccatggacagcacatggagatcaacgacgac
gtgattgaaacgtttgccttgagatatttaggcgacgatgacgatatcaaggccggtgac
gactttgtgtttgtaaaccaagctaaatag

DBGET integrated database retrieval system