KEGG   Yarrowia lipolytica: YALI0F14135gHelp
Entry
YALI0F14135g      CDS       T01033                                 

Definition
YALI0F14135p
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
yli  Yarrowia lipolytica
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    YALI0F14135g
  Lipid metabolism
   00062 Fatty acid elongation
    YALI0F14135g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     YALI0F14135g
Lipid biosynthesis proteins [BR:yli01004]
 Fatty acid synthase
  Component type
   YALI0F14135g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(1904757..1905686)
Genome map
AA seq 309 aa AA seqDB search
MKLVTLAIQLSTVLATTPVVLWHGLGDRYDSPGMTGVADQIRDIYPDIYVHSVGLSEDGG
KDQQMGLLGNVREQVESVCDQLAAIPELKGGFNAIGFSQGGLFLRSYAELCPLTNASAPV
LRKLITFGSPHNGIADMPLCGPSDFLCKSRNKLFKSQVWTKNSQTNVVVAQYYRDPNHMD
VYLEKSGFLADINNERQQKNKTYDLSYLEKFVMVMFSEDTTVVPMESAWFQEVDLESGQV
THLEDREIYQEDWIGLKKLGKRGDLEFHTVHGQHMEINDDVIETFALRYLGDDDDIKAGD
DFVFVNQAK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaactcgttactctggcaatccagctatccacagtgctagccactaccccagtggtt
ctctggcatggtctcggcgacagatatgactctccaggaatgaccggtgtggcggaccaa
atccgcgacatttaccctgacatttacgtgcattcagtcggactctctgaagacggcgga
aaagatcagcaaatgggtcttctaggcaacgtaagagagcaagttgagagtgtctgcgac
cagctggcagcaataccagagttgaagggcgggttcaatgccatcggattttcccaagga
ggtctgtttcttcgttcatacgccgagttgtgtcccttgacaaacgcctcagctcctgtt
ctccgaaagctcatcacatttggctcccctcataacggaattgctgatatgccgctctgt
gggcccagcgacttcctttgcaagtctcgtaacaagctgttcaagagtcaggtgtggact
aagaactctcaaacgaatgtggtagtggcacagtattatcgggaccctaaccacatggac
gtgtacctggagaagtctggatttctggcagacatcaacaacgagaggcaacaaaagaac
aagacctacgacctgtcttatttggagaagtttgtcatggtcatgttctcggaggatacc
acagtagtgcctatggagagtgcatggttccaagaggtggatctcgaaagtgggcaagtc
acccaccttgaagacagagagatataccaagaggactggattggacttaagaagcttgga
aagcgtggtgatcttgagttccacacggtccatggacagcacatggagatcaacgacgac
gtgattgaaacgtttgccttgagatatttaggcgacgatgacgatatcaaggccggtgac
gactttgtgtttgtaaaccaagctaaatag

DBGET integrated database retrieval system