KEGG   Yarrowia lipolytica: YALI0F15367gHelp
Entry
YALI0F15367g      CDS       T01033                                 

Definition
YALI0F15367p
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.4.19.12]
Organism
yli  Yarrowia lipolytica
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:yli00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    YALI0F15367g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YALI0F15367g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   YALI0F15367g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2071963..2074941
Genome map
AA seq 992 aa AA seqDB search
MSSAVHYAALSPHRGCGLSLSPQLRDDVSHCATQGGAKPNNHGQPHTNHHFQLNRTPVVP
MRYTNLEELGKAARQATGAVSGFKPKRMVDLALSQIEQYKQMLEMDLELAAYHIFQAREI
LFVCIPRHPDYDKFQAKKGPFHETYVELCDLAETDRRVLELISTVKGKYVREKTSGVRRQ
SNDDLLQSIDDTIRGFSHLDVQQQSAPPTETDPLKDKLEKLRGRSPEVQRATLTTNGSST
TTTKNGVMPPPKISPPPVPVPQNGGYVRQSYVGPASVPSPPPHSVTPPTPPRHTITLKAP
QLISYLGHAPETLLLLDIRPRADFQKCHIAAPNVVCVEPHLLEADMTDEQVEEKMLAALT
TEEFERFMARSAFEIVVFYDQNSTSYQTRPLKILLKALYSQAFKRPLQRPPCLLVGGLDE
WRHSGAATSFIDTRSPLQQRAELARTQTDPTPVASYDPNRVYSHPYASNYASYAYSYGPN
QSSPTPPPVPTTPPPKPPSAMSSSSSLNLPQSMALSSSTSLPDPSSYKNQMYSCHPYLNE
PLPESRHHTHGVSQPAQAARSSHGYYSHALPQLSVNTASSPIKQPPSAYSPKEKHNGEFP
SYKSVRQPIPQSPYLPHLAPMSGSPPPMSLTFTTGLKNLGNTCYINCIIQCLATSQLTKI
IVNQAYKHRVNMKSKLGYKGALIAKYADLVQALVANAYPYLVPTSFKGIIAHVNSQFSGM
EQHDCQEFLTFILDGLHEELNSVGDGQYKPRELTESEEKRREEMSVRIVSSLEWERYLKS
ASSFIVDEFQGQYQSKLQCTVCKMTSTTYTAFSSLTLPIPKYAGATLPTLYDCFNQFTQP
ELLEGENMWQCPTCKKPRPTIKSMKISRLPETLIIHLKRFDHSRGYGDKLNTFVTYPLEM
DLTRYWPPPTSEDEPFLKKLLPRGQTAPFRYSLFGVANHYGTLRGGHYTSFCKRGKLGWC
YFDDTVVNRNVNERAVVNKNAYVLFYQRRHNP
NT seq 2979 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgctgtgcactacgccgctttgtcccctcaccgagggtgtggtttgtcattg
tcacctcaacttcgtgatgatgtgtcgcactgtgccacacaaggcggagctaaacctaat
aaccatggccaaccacacacaaaccaccacttccagctcaaccgcacaccagttgtaccc
atgcgatacaccaatctagaagagctggggaaggccgcgaggcaggcaacaggggccgtg
tcgggcttcaagcccaagcgcatggtcgatctggcactatctcagatagagcagtacaag
cagatgttggagatggacctggagctggcagcctaccacatattccaggcccgcgagatt
ctgtttgtgtgcatccctcgccacccggactacgataaattccaggccaagaagggccct
ttccacgagacgtacgtggagctgtgtgacctggccgaaaccgacagacgggtgctggag
ctcatctccactgtcaagggcaagtatgtgcgggaaaagacatcgggtgtgcgacgacag
tccaacgacgacctgctgcaatccatcgacgacactatacgaggcttttcgcatctcgac
gtccaacaacagtctgccccccccacagagactgatccactcaaagacaagctggagaaa
ctgcgtggtaggagccccgaggtgcagcgggctacattgacgaccaacggcagcagcacc
accaccacgaaaaacggtgtcatgcccccaccgaagatatcgccaccgcccgttccagtg
ccgcaaaacggaggctacgtacgacagtcatatgtgggccctgcatctgtgccctcccca
ccgccccattcagtgactccgcccacaccgccacgtcacactatcacgctcaaggcgccg
cagctgatctcgtaccttggacacgctcccgagactctgctgctgctcgacattagaccc
cgagcagacttccagaaatgccatattgccgctcccaacgttgtgtgtgtggaaccgcac
ctgctggaagcagacatgacagatgagcaagtggaggagaaaatgctggctgcactgacg
acggaggagtttgagcggttcatggcccgatcggcgtttgaaatcgttgtcttctacgac
cagaacagtacaagctaccagacccgtccgctgaaaattctgctcaaggcgctctacagc
caggcgttcaagcggcctcttcaacgccctccatgtctgctggttggaggtctggacgag
tggagacactcaggagctgccacatctttcattgacacccggtcccctctacagcaaagg
gcagagctggcacgaacacaaacggatcctacccccgtggcgtcctacgaccccaacaga
gtctattcgcacccctacgccagcaactacgccagctatgcgtactcatatggtcctaac
cagtcatccccaactccccctccagtaccaaccaccccgcctccgaaacccccctctgca
atgtcgtcttcgtcgtcgctcaacctcccacaatcaatggccctatcttcatccacgtcg
ttgccggatcccagctcgtacaaaaatcaaatgtactcatgtcatccgtatctcaacgag
cccctaccggagtccaggcaccacacacacggcgtatctcagcccgcccaggctgcccgg
tcttcgcatggctattactcccatgctcttcctcagttgtcggtgaatacggcctcttca
ccgatcaaacagccgcccagtgcttattcgccaaaagaaaaacacaatggcgagttcccc
agttacaagagtgtgcgccagcctatcccacagtcgccgtacctgccccatcttgcaccc
atgtccggatcgcctccccccatgtctctgacctttaccacaggtctcaagaacctcgga
aacacctgctatatcaactgcatcatccagtgtcttgccacatcgcagctgaccaagatc
attgtgaatcaggcatacaagcatcgagtcaacatgaagtcaaagctgggatacaaggga
gctttgattgccaagtatgctgatctcgtgcaggctctagtggcgaacgcttacccttac
ttggtccccacttccttcaaaggaatcattgcacatgtcaactctcagttcagcggcatg
gagcagcatgactgtcaggaatttttgactttcattcttgatggcctgcatgaggagctc
aactctgtgggcgatggtcaatacaagccccgtgagctgaccgagagcgaggagaagcga
cgagaggagatgagtgttcgaattgtgtcatctctggagtgggagcggtacctcaagtcc
gcgtcttcgtttattgtcgacgaatttcagggccagtaccaatcaaagctccagtgtact
gtgtgcaaaatgacgtcgacgacatacactgcattctcgtcgctaactctgcccatcccc
aagtacgctggggccactctcccaacgctgtacgactgcttcaaccagtttacgcagccg
gagttgctggagggcgaaaacatgtggcagtgccctacgtgcaagaagccgcggcccact
atcaagtctatgaagatctcgcggcttccagaaactttgatcatccatctcaagcggttc
gaccactcacggggctatggagacaagctcaacacgtttgttacgtaccctctggagatg
gatctcacgcggtattggcctccgcccacatcggaggacgagcccttcttgaagaagctg
cttcctcgtggccagacggctcctttccggtactcactgtttggagtggccaaccattac
ggaacgctgcgcgggggtcattacacgtcgttctgcaagcgtggcaagctcggatggtgc
tactttgacgatacggtggtgaacagaaacgtgaacgagcgagccgttgttaacaagaat
gcgtatgtgttgttctaccagcgccggcacaatccttag

DBGET integrated database retrieval system