KEGG   Yarrowia lipolytica: YALI0F15697gHelp
Entry
YALI0F15697g      CDS       T01033                                 

Definition
YALI0F15697p
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     YALI0F15697g
Peptidases [BR:yli01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   YALI0F15697g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2122291..2123004
Genome map
AA seq 237 aa AA seqDB search
MTKSFVPLECNPEVFGGLLDAWGVSKGSFHDVFSIDEPELLAFIPRPVAALILVFPISKE
YEAYREQADAAAPDYDPTTARSEGANWWPQTITNACGTMALLHSVANGLPPSAVPENSLI
GQIVAQSDTLSTNEARAKLLEDSEPFEAAHVSVCDEGETDAPAADDPIDFHYVALVKSQK
NGHLYELDGRRKGPIDLGQLQEGEDALSQLSLNKVREFMEREKESGGYFSIIALSED
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtccttcgttcccctggagtgtaaccccgaggtctttggcggcctgctcgac
gcctggggcgtgtccaagggctcgtttcacgacgttttctccattgacgagcccgagctt
ctggccttcattccccgaccagtggctgctctgatcctggtcttccccatctcgaaagag
tatgaggcataccgagaacaggctgacgcagcagctcctgactacgatcccaccacggcg
cgatccgagggcgccaattggtggccccaaaccattactaatgcctgcggaaccatggca
cttttgcattcggtggcaaacggccttccgcccagtgctgtgcccgaaaacagtctgatt
ggccagattgtcgcccaatcggacaccctcagcacaaacgaagcccgtgccaaattgcta
gaggattccgagccgtttgaggccgcacacgtttctgtgtgtgatgaaggagagaccgac
gctcctgctgctgacgaccctatcgacttccactatgtggcactggtcaagtcgcagaag
aacggccacctgtacgagctggacggacgacgaaagggacccattgacctgggccagttg
caggagggagaagatgccctgtcgcagctgtccctgaataaggtgagagagttcatggag
agagagaaggagagtggaggatacttttccatcattgctctttctgaggattag

  All links  
No link information was found.   
DBGET integrated database retrieval system