KEGG   Yarrowia lipolytica: YALI0F15697gHelp
Entry
YALI0F15697g      CDS       T01033                                 

Definition
YALI0F15697p
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
yli  Yarrowia lipolytica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2122291..2123004
Genome map
AA seq 237 aa AA seqDB search
MTKSFVPLECNPEVFGGLLDAWGVSKGSFHDVFSIDEPELLAFIPRPVAALILVFPISKE
YEAYREQADAAAPDYDPTTARSEGANWWPQTITNACGTMALLHSVANGLPPSAVPENSLI
GQIVAQSDTLSTNEARAKLLEDSEPFEAAHVSVCDEGETDAPAADDPIDFHYVALVKSQK
NGHLYELDGRRKGPIDLGQLQEGEDALSQLSLNKVREFMEREKESGGYFSIIALSED
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtccttcgttcccctggagtgtaaccccgaggtctttggcggcctgctcgac
gcctggggcgtgtccaagggctcgtttcacgacgttttctccattgacgagcccgagctt
ctggccttcattccccgaccagtggctgctctgatcctggtcttccccatctcgaaagag
tatgaggcataccgagaacaggctgacgcagcagctcctgactacgatcccaccacggcg
cgatccgagggcgccaattggtggccccaaaccattactaatgcctgcggaaccatggca
cttttgcattcggtggcaaacggccttccgcccagtgctgtgcccgaaaacagtctgatt
ggccagattgtcgcccaatcggacaccctcagcacaaacgaagcccgtgccaaattgcta
gaggattccgagccgtttgaggccgcacacgtttctgtgtgtgatgaaggagagaccgac
gctcctgctgctgacgaccctatcgacttccactatgtggcactggtcaagtcgcagaag
aacggccacctgtacgagctggacggacgacgaaagggacccattgacctgggccagttg
caggagggagaagatgccctgtcgcagctgtccctgaataaggtgagagagttcatggag
agagagaaggagagtggaggatacttttccatcattgctctttctgaggattag

DBGET integrated database retrieval system