KEGG   Yarrowia lipolytica: YALI0F16115gHelp
Entry
YALI0F16115g      CDS       T01033                                 

Definition
YALI0F16115p
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
yli  Yarrowia lipolytica
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YALI0F16115g
Translation factors [BR:yli03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    YALI0F16115g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2163187..2165340
Genome map
AA seq 717 aa AA seqDB search
MTVEDNLDIDFSDLEEKYAVNADEGFESFIVVDGAPVIPQAKQAALANVMKKFFGAVGKI
KEDGIFIPFDEATGKSTGFVFIEYETGEMAAAAVKSFHNKQFDKNHKLLVNKLSEVEKYG
MQYDTLKTEEFVEPETEPFVEQGHLRSWLMDPQGRDQFVLHRGDTVGVFWNKKGDTLEAD
VDRERWTETQVYWSPTGTYLVSTHTQGVQLWGGPDWAPPICKFQHPNVKMVQFSPCEKFL
VTWSNVPLVLPDDEEKRKSIPFGPADEGKQIIVWNLETRLPVRTFAMPPEKKGASMSWPI
LKFSPDDKYAARMIPGEQLSIYETETMSLLDKKSVKAPGIVDFEWAPALVNLEGRQKSAT
ESVLCYWTPEIGNQTARVVLMKASNKEVLRTRNLFNVADCKIHWQDQGRFLCVKVDRHTK
SKKSTFTNLEFFRLCERGVPVEVMELKDTVTNMAWEPHGDRFVTISNSDSTTNYDGPLPA
NRHTLSFYALERHKGTQGTWKLIKAFDKKNCNSLFWSPNGRFLITVMIEGSNSIDLDFWD
MDYEGDRKHGDKDLPANLHFLGSSEHYGISALEWDPSGRFVATWSSYWRHHTENGYKIWD
FRGQLQREESIDRFKHFSWRPRPPTLLSKQQKKDIRNNLEEYSRKFEEIDAMEASEASRE
LIMLRKRLLEEWTAWRAQTDKKLEELGLVEPEPAESEYTTIEEIKEVVVEDKEEVCE
NT seq 2154 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggaggataacctcgatattgacttttccgatctggaggagaagtacgctgtc
aacgcggacgagggctttgagtctttcatcgttgtcgatggagctcctgtgattccccag
gccaagcaggcagccctggccaacgtcatgaagaagttctttggcgctgttggcaagatc
aaggaagacggcatctttattcccttcgacgaggccaccggtaagtccaccggatttgtc
ttcattgagtacgagacgggcgagatggctgctgctgccgtcaagtctttccacaacaag
cagtttgacaagaaccataagctgcttgtcaacaagctgtccgaggtggagaagtacggc
atgcagtacgacactctgaaaaccgaggagtttgtcgagcccgagaccgagccttttgtg
gaacagggacatctgcgaagctggctcatggacccccagggccgagaccagtttgtgctc
catcgaggagacacagtcggagtcttctggaacaaaaagggtgatactctggaggctgac
gttgaccgagagcgatggaccgagacccaggtctactggtctcccaccggtacttacctt
gtgtctactcatactcaaggtgttcagctgtggggtggccccgactgggctcctcctatc
tgcaaattccagcatcccaacgtcaagatggtgcagttttctccctgcgagaagttcctt
gtcacctggtctaacgttcctctcgttctccctgatgacgaggagaagcgaaagagcatt
ccttttggccccgctgacgagggcaaacagatcattgtatggaacctcgagactcgactt
cccgtccgaacctttgctatgcccccggagaagaagggcgcctctatgtcctggcccatt
ctcaagttctctcctgacgacaagtacgctgcccgtatgatccccggagagcagctgtct
atctacgagaccgagaccatgtctctgctggataagaagtccgtcaaggctcccggtatc
gtcgactttgagtgggctcctgctcttgttaacctggagggacgacaaaagtccgccact
gagtctgttctctgctactggactcctgaaattggcaaccagaccgctcgagtggtcctc
atgaaggcttccaacaaggaggtgctgcgaacccgaaacctgttcaacgtggccgattgt
aagatccactggcaggaccagggacgcttcctgtgcgtcaaggtcgaccgacacacaaag
tccaagaagtctacctttaccaacctcgagttcttccgactgtgcgagcgaggagtgccc
gtcgaggttatggagctcaaggacaccgtcaccaacatggcctgggagccccacggagac
cgattcgtcaccatttccaactcggactccaccaccaactacgacggtcctctgcccgcc
aaccgacacactctgtccttctacgctcttgagcgacacaagggaacccagggcacatgg
aagctgatcaaggcatttgacaagaagaactgtaactctctgttctggtcccctaacggt
cgattcctcatcactgtcatgattgagggctctaactctatcgatctcgacttctgggac
atggactacgagggtgaccgaaagcacggtgacaaggatcttcctgccaacctgcacttc
ctcggctcgtccgagcactacggtatctctgctctcgagtgggatccctctggacggttt
gtcgccacctggtcttcctactggagacaccacaccgaaaacggatacaagatctgggac
ttccgaggccagctgcagcgagaggagtccattgaccgattcaagcacttttcctggaga
ccccgaccccctactctgctctccaagcagcagaagaaggatatccgaaacaacctggag
gagtactctcgaaagtttgaggagatcgacgccatggaggcttccgaggcttctcgagag
cttatcatgctgcggaagcgactgctcgaggagtggaccgcctggagagcccagactgac
aagaagctcgaggagctgggtcttgtcgagcccgagcctgccgagtccgagtacaccacc
atcgaggagatcaaggaggttgttgtcgaagataaggaggaggtttgcgagtaa

DBGET integrated database retrieval system