KEGG   Yarrowia lipolytica: YALI0F16709gHelp
Entry
YALI0F16709g      CDS       T01033                                 

Definition
YALI0F16709p
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
yli  Yarrowia lipolytica
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YALI0F16709g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     YALI0F16709g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YALI0F16709g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2237628..2239304
Genome map
AA seq 558 aa AA seqDB search
MDQKTDSREYLDGFKAGQKVAYERLYWRRILVLFGGLAMVLGFFGYKGYAVNDVLDLDLS
MSRADSVNDNPLVSPLSKPKKNVIFMVTDGMGPASVSLARTYRQYVQGLAYNNTLTIDKH
FIGSSRTRSSDSPVTDSAAGATAFSCGAKSYNGAISVTPDYKACGSVLEAAKRQGLKTGL
VVTTRITDATPACFGAHVAHRSQEDEIADQLLGYATPLGRSVDLLMGGGRIHFTTKGRQD
GRDLIAEAQIDGFQYIANRKEFDELDTSNATLPLLALFTDYDMPYEIDRVPEQFPSLKET
AISALEILHQETKDSDEGFFIMIEGSRIDHAGHQNDPAAQVREVMAFDEMFAAVVDFADS
LDTETIIVSTSDHETGGLAIARQVQAEYPEYVWYPEALAAAQHSGEYIARKLQAFARPDH
PSEASGSKLEKFVKREILENDLGVKDYTKQEVKALIRNRADPIDTIVDIVSRRSQTGWST
HGHSAVDVNIYAHSNKQSGLDKLDALRGNHENIEIGQFLAKYLEVDVARVTEILEDLPVR
VQHVEEIDDCDQYHHGLY
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaaaaccgactcgcgcgagtatctcgacgggttcaaggccggccagaaggtg
gcgtacgagcggctctactggcgacgaatcctcgtgctgtttggaggtctggccatggtg
ctgggtttctttggctataaaggatacgctgtcaatgacgtacttgacctggatctgtcc
atgtcgcgagccgactctgtcaacgacaatccccttgtttctcctctgtccaagcccaag
aaaaacgtcatcttcatggtcaccgatggtatgggacctgcttccgtttctctggcccga
acctaccgacagtacgtccagggactggcctacaacaacaccctgaccatcgacaagcac
tttattggctcgtcgcgaacccgatccagtgactcccccgtcactgactctgccgctggt
gccaccgccttctcctgtggtgccaagtcctacaacggagcaatctccgtcacccccgac
tataaggcctgtggcagtgttctcgaagctgccaagcgacaaggtctcaagaccggactg
gtggtgaccactcggatcaccgacgcgacccctgcttgtttcggagcccatgttgctcac
cggtctcaggaggacgagattgctgaccagctgctgggctacgctactcccctcggccgt
tctgtcgacttgctcatgggtggcggacgaatccatttcacaaccaagggccgacaggat
ggccgtgatctgattgctgaagcccagatcgacgggttccaatacattgccaaccgaaag
gagtttgacgagctcgatacttccaacgccaccctaccccttctcgctctcttcaccgac
tacgacatgccctacgagattgaccgagtccccgagcagttcccctctctcaaggagacc
gcaatctctgcccttgagattcttcaccaggagaccaaggactccgacgagggattcttc
atcatgatcgaaggttctcgaattgatcacgccggccaccagaatgaccccgctgctcag
gtcagagaggttatggcattcgacgagatgtttgctgccgtcgttgactttgccgattct
cttgacaccgaaaccatcattgtctccacctccgaccacgagactggaggcctggctatc
gctcgacaggtccaggctgagtaccccgagtacgtctggtaccccgaggctcttgctgct
gcacagcactctggagagtacattgctcgaaagctgcaggcgtttgctcgacccgaccac
ccttccgaggcctctggctcgaagctggagaagttcgtcaagcgagagatcctcgagaac
gatcttggagtcaaggactacaccaaacaggaggtcaaggctctgattagaaaccgggct
gaccccattgacaccattgtcgacattgtttctcgacgatcccagacgggctggtctacg
cacggccactccgccgtcgatgtcaacatctacgctcactccaacaagcagagcggtctc
gacaagttggatgctctgcgaggaaatcacgagaacattgagattggtcagtttctggcc
aagtacctggaggtggacgttgctcgagtgacggagattctcgaggaccttcccgttcgt
gttcagcacgttgaggagattgatgactgtgaccagtaccatcatggtttgtattaa

DBGET integrated database retrieval system