KEGG   Yarrowia lipolytica: YALI0F17864gHelp
Entry
YALI0F17864g      CDS       T01033                                 

Definition
YALI0F17864p
Orthology
K03259  
translation initiation factor 4E
Organism
yli  Yarrowia lipolytica
Pathway
RNA transport
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:yli03013]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2377762..2378469
Genome map
AA seq 235 aa AA seqDB search
MDPNTVVNENNEVVVTPRLGQRILESQWTIWFFYRAQGVRISNYEAATKRVCTFATVEEF
WSFYGHLKHVDKLPYTSEFQVFRRGIKPMWEDSHNVCGGKWVCRLRRPSKQFAKLDNDDD
IVVPTRAPPMQIASLRHQAAVYWEKLLLALVGGTLLPEGQYQDEIVGAVISVRKEEDIIS
VWNRTSNDPQVTEAIRAGMQAVLGVPESVTFEYKVHSDSLKEGVEKQALYETEEK
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggaccccaacacggtggtcaacgaaaacaacgaggtggtggtgaccccacggctgggc
caacggatcctggagtcccagtggaccatctggtttttctatcgggctcagggcgtgcga
atctccaactacgaggcggccaccaagcgagtatgcacttttgccaccgtggaggagttt
tggtcgttctacggacatctgaaacatgtcgacaagctgccatacacctccgagttccag
gtctttcgacggggaatcaagcccatgtgggaagacagccacaacgtgtgcggaggcaaa
tgggtgtgcagattgagacgaccttcgaagcagtttgccaaactggacaacgatgacgat
attgttgtgcccactagagcccctcccatgcagattgcctctctcaggcaccaggcagca
gtatactgggaaaagctattgttggccctggttggcggtactctgttgcccgagggccag
taccaggacgagattgtaggagctgtcatctcggtacgaaaggaggaggatatcatttcc
gtgtggaaccggactagcaacgatccccaggtgactgaggctattcgagcaggaatgcag
gcggttctgggagttcctgaaagtgtgacctttgagtacaaggtgcactcggacagtctc
aaggagggagtggagaaacaggctctgtacgagaccgaggagaagtag

DBGET integrated database retrieval system