KEGG   Yarrowia lipolytica: YALI0F18502gHelp
Entry
YALI0F18502g      CDS       T01033                                 

Definition
YALI0F18502p
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
yli  Yarrowia lipolytica
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YALI0F18502g
Enzymes [BR:yli01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     YALI0F18502g
Glycosyltransferases [BR:yli01003]
 Polysaccharide
  Storage polysaccharide
   YALI0F18502g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2472418..2474490
Genome map
AA seq 690 aa AA seqDB search
MTRDTRNHLLFEVATEVANRVGGIYSVIKSKAPVTVYEYGDRYHLIGPLNRKSADIEVEE
ITDESQIPEAINKTLKSMAERGIQYVYGRWLIEGAPRVILFDLGSAWGYLPEWKSDLWTV
AGIPAPEGDKESNDAVVLGYLVAWFLGELTTHETERAVIAHFHEWLSGIALPLCKKRRID
CTTIFTTHATLLGRYLCAGSVDFYNNLQGFDVDAEAGKRGIYHRYCIERAASHSADVFTT
VSHITAYESEHLLKRKPDGVVPNGLNVVKFSAMHEFQNLHALMKDKINQFVKGHFYGHLD
FDLDDTLYTFTAGRYEYRNKGVDMFIESLARLNHRLKSEKSTKTIVAFIIMPAQTSSYTV
ETLKGQAVMKALEDTVNEIQQQIGRRMLDHCARHNSHDGKEIPGLDQLLSPSDRVLLKRR
VFALKRETFPPIVTHNMVDDSTDPILNQIRRVQLFNRPEDRVKIIFHPEFLNSNNPILPL
DYDDFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGCYMEDLIENASDYGIY
IVDRRLKSIDESVDQLTDYMFEFSKKSRRQRINQRNRTERLSDLLDWKRMGREYIKARQL
ALRRAYPDQFDHEENPFEDEEPLKLTRPLSVPGSPRDRAGLMTPGDLGSLGEIGEGLDTD
DYVGFRLPQDDDDEEETSYPATLTLAGSRK
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgacgagggacacacgaaaccacctgctgttcgaggtcgccaccgaggtcgccaaccgg
gtcggcggaatctactcggtcatcaagtccaaggcccccgtcaccgtctacgagtacggg
gaccggtaccacctgattggacccctcaaccgcaagtcggccgacattgaggtggaggag
atcaccgacgagtcccagattcccgaagccatcaacaaaacactaaagtccatggcggaa
cgaggcatccagtacgtctacggccgatggctcattgagggcgctccccgagtcattctc
ttcgacctgggctccgcctggggctaccttcccgagtggaagagtgatctgtggactgtg
gccggtatccccgcccccgagggcgacaaggagtccaacgacgccgttgtgttgggctac
ttggtggcctggttcctgggagagctgaccacccacgaaaccgagcgggccgtcattgcc
cacttccacgagtggctgtccggtattgctctgcctctgtgcaaaaagcgacgaatcgac
tgcaccaccatcttcaccacacacgctactctgctgggccgatacctgtgcgccggctcg
gtcgacttctacaacaacctgcagggcttcgacgtggacgccgaggccggaaagcgaggc
atctaccaccgatattgcattgagcgggcggcttcccactcggccgacgttttcaccacc
gtgtcgcacatcaccgcctacgagtccgagcacctgctcaagcgaaagcccgacggtgtg
gtgcccaacggtctcaacgtggtcaagttttcggccatgcacgagttccagaacctgcat
gccctgatgaaggacaagatcaaccagtttgtcaagggccacttttacggtcacctggac
tttgatctcgacgacactctgtatacctttactgccggccgatacgagtaccgaaacaag
ggtgtagacatgttcatcgagtctctcgcccgtctcaaccacagattgaagagtgagaag
tccaccaagaccattgtggcctttatcatcatgcccgcccagacctcatcatacacagtg
gagaccctcaagggccaggccgttatgaaggctctggaggacaccgtcaacgaaatccag
cagcagattggccgacgaatgctcgaccattgtgcccgccacaacagccacgacggaaag
gagatccccggcctcgaccagctgctttccccctccgacagagtgctgctcaagcgacga
gtgtttgccctcaagcgagaaaccttccctcccattgtcacccacaacatggtggacgac
tccacagaccccattctcaaccagatccgacgggtacagctgttcaaccggcccgaggac
cgggtcaagattatcttccaccccgagttcctcaactccaacaaccctatcctgcctctc
gactacgacgactttgtgcgaggctgtcatctcggagtcttcccctcctactacgagcct
tggggatacacccccgccgagtgcaccgtcatgggcgttccttccatcaccaccaacctc
tctggtttcggctgctacatggaggatctcattgagaacgcctccgactacggcatctac
attgtggaccgtcgtctcaagtctattgacgagagtgttgaccagctaaccgactacatg
tttgagttctccaagaagtcgcgacgtcagcgaattaaccagcgaaaccgaaccgagcga
ctgtccgatctgctggactggaagcgaatgggccgagagtacatcaaggctcgacagctg
gctcttcgacgagcctaccccgaccagtttgaccacgaggagaaccccttcgaagacgag
gagcctctcaagctgactcgacctctatctgtgcctggatccccccgtgaccgagccggt
ctcatgactcccggtgatcttggatctctgggtgagattggcgagggtcttgacactgac
gattatgtgggcttccgacttccccaggatgatgatgacgaggaggagactagctaccct
gccactctcactctagccggtagcagaaagtag

DBGET integrated database retrieval system