KEGG   Yarrowia lipolytica: YALI0F20504gHelp
Entry
YALI0F20504g      CDS       T01033                                 

Definition
YALI0F20504p
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
yli  Yarrowia lipolytica
Brite
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     YALI0F20504g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:2727200..2728222
Genome map
AA seq 340 aa AA seqDB search
MRSFRAVRNFSTTAKRLSQAPKASTPNASSGNGFVLAFVAAAAGAGAYYYYANSPAAKVE
TFNATKADYQKVYDAIADKLIEDDDYDDGSYGPVLLRLAWHSSGTYNKSDNKFGSSGGTM
RFKPEASHAANNGLVNARNFLKPIHEKFPWISTGDLYTLGGVTAVQELGGPIIPWKRGRV
DEPESASPPDGSLPDASQGATHVRNVFNRQGFNDQEMVALIGAHALGRCHKQNSGFEGPW
TFSPTMFTNDFYKLLLDDKWQWKKWDGNPQYEDVKTKSLMMLPTDMALATDKNFKKWATA
YAKDQDLFFKDFSAAFSKMLNNGVDFPQGTEIWEFKPKNA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctttccgagcagtccgaaacttctccaccaccgccaagcgcctcagccaggcc
cccaaggcctccactcctaacgcctcctctggaaacggctttgtgttggcctttgtggcc
gccgccgctggagccggtgcctactactactacgccaactcccctgccgccaaggtcgag
accttcaacgccaccaaggccgactaccagaaggtgtacgacgctattgccgacaagctg
attgaggacgacgactatgatgatggatcttacggacccgtcctcctgcgactcgcctgg
cactcgtctggtacctacaacaagtctgataacaagtttggctcttccggaggtaccatg
cgattcaagcccgaggcttctcatgctgccaacaatggcctggttaacgccagaaacttc
ctcaagcccatccacgagaagttcccttggatctccaccggtgatctgtacactcttggt
ggtgtcaccgccgtccaggagctcggtggccctatcatcccctggaagcgaggccgtgtc
gacgagcccgagtctgcttctcctcccgatggatctcttcccgacgcctctcagggcgct
actcatgtgcgaaacgttttcaacagacagggcttcaacgaccaggagatggttgctttg
attggagctcacgctctcggccgatgccacaagcagaactctggcttcgagggcccctgg
actttctcccctaccatgttcaccaacgatttctacaagctcctgctcgacgataagtgg
cagtggaagaagtgggacggaaaccctcagtacgaggacgtcaagaccaagtctctgatg
atgctgcccaccgacatggctcttgctaccgacaagaacttcaagaagtgggccactgcc
tacgctaaggaccaggatctcttcttcaaggacttttctgctgcattctccaagatgctc
aacaacggtgttgacttcccccagggaactgagatctgggagttcaagcccaagaacgcc
taa

DBGET integrated database retrieval system