KEGG   Yarrowia lipolytica: YALI0F20790gHelp
Entry
YALI0F20790g      CDS       T01033                                 

Definition
YALI0F20790p
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
yli  Yarrowia lipolytica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    YALI0F20790g
Enzymes [BR:yli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     YALI0F20790g
Exosome [BR:yli04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YALI0F20790g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(2773553..2774581)
Genome map
AA seq 342 aa AA seqDB search
MVHKAEYLEEHETQISSILSGGYAHPLSRQWQQKNRLTKDMFIYPLFVTDDPEEETPISS
LPGQKRWGVNKLVPYVDSLVKKGLRSVILFGVPMKEGVKDLEGTAADDPEGPVIQATKAL
KKAFPDLFVMCDVCLCEYTSHGHCGVLREDGTVIRDTTVRRLAAVAVNYAKAGADCVAPS
DMIDGRIHDIKKGLLKAGLAHNVMVMSYTKFSGNLYGPFREAACSAPSHGDRKRYQLPAG
GRGLARRALARDLAEGADAVIVKPSTFYLDIVVDAAEICKDVPIATYQVSGEYAMIHAAA
EKGVVDLEVMAFEAAYGNLRAGANLLISYFTPDFLEWLDHHH
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggtccacaaagccgagtaccttgaagaacacgagacccagatctcctccattctgagc
ggcggttacgcccaccctctgtctcgacagtggcagcagaagaaccgcctcaccaaggat
atgttcatctatcctcttttcgtcactgatgatcccgaggaggagactcctatcagctct
cttcccggccagaagcgatggggcgtcaacaagctggtgccctacgtcgactctctggtc
aagaagggcctccgatctgtcattcttttcggtgttcctatgaaggagggtgttaaggat
cttgagggaactgctgcggatgatcccgagggacccgttattcaggccaccaaggctctc
aagaaggccttccctgacctgtttgtcatgtgtgacgtttgcctgtgcgagtacacctcg
cacggtcactgcggcgttcttcgagaggacggaactgttatccgagacacaactgtgcga
cgtttggctgccgtggctgtcaattacgccaaggcaggagctgactgtgtggcaccctcg
gacatgattgacggtcgaatccacgacatcaaaaagggcttgctcaaggccggtcttgcc
cacaacgtcatggttatgagctacactaagttctccggaaacctgtacggacctttccga
gaggctgcctgctctgctcccagccacggagaccgaaagcgataccagctccccgctggc
ggtcgaggtctcgctcgacgagctcttgctcgagacctggccgaaggtgccgatgccgtc
attgtcaagccttccaccttttacctggatatcgtggtggacgctgctgagatctgcaag
gacgtgcctattgctacctaccaggtttccggagagtacgccatgatccacgcagctgcc
gagaagggcgttgttgatctggaggtgatggccttcgaggcggcctacggtaacctgcga
gccggagccaacctccttatctcttactttacccccgactttctcgagtggttggaccac
caccactaa

DBGET integrated database retrieval system