KEGG   Yarrowia lipolytica: YALI0F23221gHelp
Entry
YALI0F23221g      CDS       T01033                                 

Definition
(RefSeq) YALI0F23221p
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
yli  Yarrowia lipolytica
Pathway
yli00260  Glycine, serine and threonine metabolism
yli00750  Vitamin B6 metabolism
yli01100  Metabolic pathways
yli01110  Biosynthesis of secondary metabolites
yli01230  Biosynthesis of amino acids
Module
yli_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YALI0F23221g
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    YALI0F23221g
Enzymes [BR:yli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     YALI0F23221g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 2908784
NCBI-ProteinID: XP_505779
UniProt: Q6C0N3
Position
F:complement(3045230..3046747)
Genome map
AA seq 505 aa AA seqDB search
MTTYFSTRSSNEPISFEAAVMKGLAPDGGLYIPTSIPKLPSDFLTKWADLSFAELAFEIL
SLYIPESEISRADLKELVTRSYSTFRSDEVTPVVELSKEKQLYLLELFHGPTYAFKDVAL
QFVGNLFEYFLTRKNVGKEGTDRDTLTVVGATSGDTGSAAIYGLRGKKDVSVFILYPTGR
VSPIQEDQMTTVSDANVHTISVAGTFDDCQDIVKQVFGDAEFNAKHHVGAVNSINWARIL
AQITYYFHSFFQVQKKFGTSSAIKYSVPTGNFGDILAGFYARRMGLPIQELTIATNSNDI
LDRFLKTGSYSKSDGASAEVHATLSPAMDILVSSNFERFLWYVARENVASSDAEAGATLN
KWMQSLKTDGVITVDAKVLGAAKSEFSSERVSDEQTLETIKDVFTNISKGYILDPHSSVG
VTAALRKLEGTDSVYIALSTAHPAKFSDAVDQALKGLEGYNFERDVLPQEFKDFANKDKK
KLFSKADVKEVESIIEEELAKEKKQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctacttttccacgcgatcatccaatgagcccatttccttcgaggctgccgtc
atgaagggtctggcccccgatggaggtctttacattcccacctccatccccaagctgccc
tccgacttcctcaccaagtgggccgatctgagctttgccgagttggccttcgagattctc
agtctgtacattcccgagtctgagatctcgcgagccgacctgaaggagcttgtcacccgg
tcctactctactttccgatccgacgaggtcacccccgtggttgagctcagcaaggagaag
cagctttatctgctggagctattccacggccccacctacgccttcaaggacgtggctctg
cagtttgttggcaacctgtttgagtacttcctgacccgaaagaacgttggcaaggagggc
accgaccgagatactcttaccgtcgtgggagccacctctggtgacaccggctccgccgcc
atctacggtctgcgaggcaagaaggacgtttctgtcttcattctgtaccccaccggccga
gtctcccccatccaggaggaccagatgacgactgtctctgacgccaacgtgcacactatc
tccgttgctggtacctttgacgactgccaggacattgttaaacaggtctttggtgatgcc
gagtttaacgccaagcaccacgtcggtgccgtcaactctatcaactgggcccgaatcctc
gcccagatcacctactacttccactccttcttccaggtccagaagaagttcggcacctcc
tccgccatcaagtactctgtccccactggtaactttggagacattctcgctggcttttac
gcccgacgaatgggtctgcccatccaggagctcaccatcgccactaactccaacgacatt
ctcgaccgattcctcaagactggctcctactcgaaatccgacggagcttctgccgaggtc
catgccaccctttcccccgccatggacatcctcgtctcctccaactttgagcgattcctt
tggtacgttgcccgagagaacgttgcttcttcggacgctgaggctggagccaccctcaac
aagtggatgcagtctctcaagaccgacggtgtcatcactgtcgacgccaaggtccttgga
gccgcaaagtccgagttttcctccgagcgagtctccgacgagcagactctcgagaccatt
aaggatgtgtttaccaacatttccaagggctatattttggacccccactcctctgttggt
gtcactgccgctctgcgaaagcttgagggaaccgactccgtgtacattgctctgtcaacc
gctcaccccgccaagttctctgacgccgtcgaccaggccctcaagggtctcgagggctac
aactttgagcgagatgttctccctcaggagttcaaggactttgctaacaaggacaagaag
aagctgttcagcaaggccgacgtcaaggaggtcgaaagcatcattgaggaggagctggcc
aaggagaagaagcagtaa

DBGET integrated database retrieval system