KEGG   Yarrowia lipolytica: YALI0F23221gHelp
Entry
YALI0F23221g      CDS       T01033                                 

Definition
YALI0F23221p
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
yli  Yarrowia lipolytica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:yli01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:yli00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:yli00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(3045230..3046747)
Genome map
AA seq 505 aa AA seqDB search
MTTYFSTRSSNEPISFEAAVMKGLAPDGGLYIPTSIPKLPSDFLTKWADLSFAELAFEIL
SLYIPESEISRADLKELVTRSYSTFRSDEVTPVVELSKEKQLYLLELFHGPTYAFKDVAL
QFVGNLFEYFLTRKNVGKEGTDRDTLTVVGATSGDTGSAAIYGLRGKKDVSVFILYPTGR
VSPIQEDQMTTVSDANVHTISVAGTFDDCQDIVKQVFGDAEFNAKHHVGAVNSINWARIL
AQITYYFHSFFQVQKKFGTSSAIKYSVPTGNFGDILAGFYARRMGLPIQELTIATNSNDI
LDRFLKTGSYSKSDGASAEVHATLSPAMDILVSSNFERFLWYVARENVASSDAEAGATLN
KWMQSLKTDGVITVDAKVLGAAKSEFSSERVSDEQTLETIKDVFTNISKGYILDPHSSVG
VTAALRKLEGTDSVYIALSTAHPAKFSDAVDQALKGLEGYNFERDVLPQEFKDFANKDKK
KLFSKADVKEVESIIEEELAKEKKQ
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctacttttccacgcgatcatccaatgagcccatttccttcgaggctgccgtc
atgaagggtctggcccccgatggaggtctttacattcccacctccatccccaagctgccc
tccgacttcctcaccaagtgggccgatctgagctttgccgagttggccttcgagattctc
agtctgtacattcccgagtctgagatctcgcgagccgacctgaaggagcttgtcacccgg
tcctactctactttccgatccgacgaggtcacccccgtggttgagctcagcaaggagaag
cagctttatctgctggagctattccacggccccacctacgccttcaaggacgtggctctg
cagtttgttggcaacctgtttgagtacttcctgacccgaaagaacgttggcaaggagggc
accgaccgagatactcttaccgtcgtgggagccacctctggtgacaccggctccgccgcc
atctacggtctgcgaggcaagaaggacgtttctgtcttcattctgtaccccaccggccga
gtctcccccatccaggaggaccagatgacgactgtctctgacgccaacgtgcacactatc
tccgttgctggtacctttgacgactgccaggacattgttaaacaggtctttggtgatgcc
gagtttaacgccaagcaccacgtcggtgccgtcaactctatcaactgggcccgaatcctc
gcccagatcacctactacttccactccttcttccaggtccagaagaagttcggcacctcc
tccgccatcaagtactctgtccccactggtaactttggagacattctcgctggcttttac
gcccgacgaatgggtctgcccatccaggagctcaccatcgccactaactccaacgacatt
ctcgaccgattcctcaagactggctcctactcgaaatccgacggagcttctgccgaggtc
catgccaccctttcccccgccatggacatcctcgtctcctccaactttgagcgattcctt
tggtacgttgcccgagagaacgttgcttcttcggacgctgaggctggagccaccctcaac
aagtggatgcagtctctcaagaccgacggtgtcatcactgtcgacgccaaggtccttgga
gccgcaaagtccgagttttcctccgagcgagtctccgacgagcagactctcgagaccatt
aaggatgtgtttaccaacatttccaagggctatattttggacccccactcctctgttggt
gtcactgccgctctgcgaaagcttgagggaaccgactccgtgtacattgctctgtcaacc
gctcaccccgccaagttctctgacgccgtcgaccaggccctcaagggtctcgagggctac
aactttgagcgagatgttctccctcaggagttcaaggactttgctaacaaggacaagaag
aagctgttcagcaaggccgacgtcaaggaggtcgaaagcatcattgaggaggagctggcc
aaggagaagaagcagtaa

DBGET integrated database retrieval system