KEGG   Yarrowia lipolytica: YALI0F24893gHelp
Entry
YALI0F24893g      CDS       T01033                                 

Definition
YALI0F24893p
Orthology
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
yli  Yarrowia lipolytica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YALI0F24893g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YALI0F24893g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YALI0F24893g
Enzymes [BR:yli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YALI0F24893g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(3221937..3224015)
Genome map
AA seq 692 aa AA seqDB search
MSAHLAATFEQCKKEGRPALVTFVTAGFPSVEKTVPILEGLQTGGADVIELGIPFTDPVA
DGPAIQAANNVALANGVTVHSCLDLVKQARAKGVHVPIVLMGYYNPIHHFGDEKFVKAAR
DAGANGFIIVDLPPEEAVAFRGLCTREGLSYVPLVAPTTPNDRLEVLASITDSFMYVVSR
MGVTGATGKLSTDIDELVAKVRKYTGGKPLAVGFGVSTQEHFNQLAPLADGIVIGSKIIA
TIEESNGSPEAVAKYLQSVTGGRAASAAVSNENKSDTTQAVNTDEVLRKSVYPARFGVHG
GQYVPESLHRCLLELETCVEEAFADESFWEEFRSYFAYMNRPSSFHEAERLTEHCGGAKI
WLKREDLNHTGSHKINNAVGQVILAKRLGKKELIAETGAGQHGVATATVAAKFGMKCKVF
MGAEDARRQSLNVFRMRMLGAEVVKVEEGSKTLRDAVNEALRFWVTNLESTHYVIGSAIG
PHPYPTLVRTLQSVIGRETKEQFAALNNGALPDAVVACVGGGSNSSGMFAPFENDKSVRL
VGVEAGGDGIDTPAHSATLTKGQVGVFQGVKTYVLQNADGQIQDTHSISAGLDYPGVGPE
LSYWKDTGRVEFVAASDADALNAFRQLTQLEGIIPALESSHAIHGAMELAKKLPKDKNVV
ICLSGRGDKDVQNVAEQLPKLGPKIDWDLRFE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcatctggctgccactttcgagcagtgcaagaaggagggccgtcccgccctc
gttaccttcgtcaccgcaggattcccctctgttgaaaaaaccgtgcccattctcgagggc
ctccagaccggaggagccgacgtgattgagctcggcatccccttcaccgaccctgttgcc
gacggccctgccatccaggccgccaacaatgtggctcttgccaacggtgtcaccgtccac
tcgtgtctggaccttgtcaagcaggctcgagccaagggcgtccacgtccccattgtgctc
atgggctactacaaccctatccaccattttggtgacgagaagtttgtcaaggctgcccga
gacgctggagccaacggtttcattatcgtcgaccttcccccggaggaggctgttgctttc
agaggcctctgcactcgtgagggtctgtcttacgtccctctggtcgcccccaccaccccc
aacgaccgtcttgaggtcctcgcttccatcaccgactctttcatgtacgtcgtctcgcga
atgggcgtcactggcgccaccggcaagctgtctaccgacattgacgagctcgtggctaag
gtccgaaagtacactggaggcaagcctctggcagttggctttggagtgtccacccaggag
cacttcaaccagctggcccccctggccgacggtattgtcattggatccaagatcattgcc
accatcgaggagtccaacggatcccccgaggctgtcgccaagtacctgcagtctgtgact
ggtggacgagcagcctctgccgctgtgtccaacgaaaacaagtccgacactacccaggcc
gtcaacaccgacgaggtgctgcgaaagtctgtctaccctgcccgattcggtgttcacgga
ggccagtacgtacccgagtctctgcaccgatgtctgctggagctcgagacttgcgtcgag
gaggcctttgctgatgaatctttctgggaggagttccgatcctactttgcctacatgaac
cgaccctcctccttccatgaggccgagcgactcaccgagcactgcggaggagccaagatc
tggctcaagcgagaggacctcaaccacaccggttctcacaagatcaacaatgccgtcggt
caggtcattcttgccaagcgattgggcaagaaagagctcattgccgagaccggagccggc
cagcacggtgttgctaccgccactgttgccgccaagttcggcatgaagtgcaaggtcttt
atgggtgctgaggacgcccgacgacagtctctcaacgtgttccgtatgcgaatgcttggt
gccgaggttgtcaaggtcgaggagggctccaagactctgcgagacgccgtcaacgaggct
ctgcgattctgggtcaccaacctcgagtcaacccactacgtcattggttctgccattggc
cctcacccctaccccactctggtgcgaactcttcagtccgttattggccgagagaccaag
gagcagtttgctgccctcaacaacggtgctctgcctgatgccgttgtcgcctgtgtcggc
ggtggatccaactcctccggtatgtttgctcccttcgagaacgacaagtctgtgcgactt
gttggtgtcgaggctggaggagacggtattgatacacccgcccactctgctaccctcact
aagggccaggtcggagtgttccagggagtcaagacctacgttctgcagaacgccgatggt
cagatccaggacacacactctatctccgctggtctggactaccccggtgtcggtcctgag
ctgtcctactggaaggatactggccgagttgagtttgttgctgcctccgatgccgacgct
ctcaacgccttccgacagctgacccagctggagggtatcattcccgcccttgagtcgtcg
cacgccatccacggtgccatggagctggccaagaagctgcccaaggacaagaacgtggtc
atctgtctctctggacgaggagacaaggacgtgcagaacgttgctgagcagctgcccaag
ctcggtcccaagattgactgggacctgcgatttgagtaa

DBGET integrated database retrieval system