KEGG   Yarrowia lipolytica: YALI0F24893gHelp
Entry
YALI0F24893g      CDS       T01033                                 

Definition
(RefSeq) YALI0F24893p
  KO
K01694  
tryptophan synthase [EC:4.2.1.20]
Organism
yli  Yarrowia lipolytica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YALI0F24893g
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YALI0F24893g
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YALI0F24893g
Enzymes [BR:yli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YALI0F24893g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(3221937..3224015)
Genome map
AA seq 692 aa AA seqDB search
MSAHLAATFEQCKKEGRPALVTFVTAGFPSVEKTVPILEGLQTGGADVIELGIPFTDPVA
DGPAIQAANNVALANGVTVHSCLDLVKQARAKGVHVPIVLMGYYNPIHHFGDEKFVKAAR
DAGANGFIIVDLPPEEAVAFRGLCTREGLSYVPLVAPTTPNDRLEVLASITDSFMYVVSR
MGVTGATGKLSTDIDELVAKVRKYTGGKPLAVGFGVSTQEHFNQLAPLADGIVIGSKIIA
TIEESNGSPEAVAKYLQSVTGGRAASAAVSNENKSDTTQAVNTDEVLRKSVYPARFGVHG
GQYVPESLHRCLLELETCVEEAFADESFWEEFRSYFAYMNRPSSFHEAERLTEHCGGAKI
WLKREDLNHTGSHKINNAVGQVILAKRLGKKELIAETGAGQHGVATATVAAKFGMKCKVF
MGAEDARRQSLNVFRMRMLGAEVVKVEEGSKTLRDAVNEALRFWVTNLESTHYVIGSAIG
PHPYPTLVRTLQSVIGRETKEQFAALNNGALPDAVVACVGGGSNSSGMFAPFENDKSVRL
VGVEAGGDGIDTPAHSATLTKGQVGVFQGVKTYVLQNADGQIQDTHSISAGLDYPGVGPE
LSYWKDTGRVEFVAASDADALNAFRQLTQLEGIIPALESSHAIHGAMELAKKLPKDKNVV
ICLSGRGDKDVQNVAEQLPKLGPKIDWDLRFE
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgtctgctcatctggctgccactttcgagcagtgcaagaaggagggccgtcccgccctc
gttaccttcgtcaccgcaggattcccctctgttgaaaaaaccgtgcccattctcgagggc
ctccagaccggaggagccgacgtgattgagctcggcatccccttcaccgaccctgttgcc
gacggccctgccatccaggccgccaacaatgtggctcttgccaacggtgtcaccgtccac
tcgtgtctggaccttgtcaagcaggctcgagccaagggcgtccacgtccccattgtgctc
atgggctactacaaccctatccaccattttggtgacgagaagtttgtcaaggctgcccga
gacgctggagccaacggtttcattatcgtcgaccttcccccggaggaggctgttgctttc
agaggcctctgcactcgtgagggtctgtcttacgtccctctggtcgcccccaccaccccc
aacgaccgtcttgaggtcctcgcttccatcaccgactctttcatgtacgtcgtctcgcga
atgggcgtcactggcgccaccggcaagctgtctaccgacattgacgagctcgtggctaag
gtccgaaagtacactggaggcaagcctctggcagttggctttggagtgtccacccaggag
cacttcaaccagctggcccccctggccgacggtattgtcattggatccaagatcattgcc
accatcgaggagtccaacggatcccccgaggctgtcgccaagtacctgcagtctgtgact
ggtggacgagcagcctctgccgctgtgtccaacgaaaacaagtccgacactacccaggcc
gtcaacaccgacgaggtgctgcgaaagtctgtctaccctgcccgattcggtgttcacgga
ggccagtacgtacccgagtctctgcaccgatgtctgctggagctcgagacttgcgtcgag
gaggcctttgctgatgaatctttctgggaggagttccgatcctactttgcctacatgaac
cgaccctcctccttccatgaggccgagcgactcaccgagcactgcggaggagccaagatc
tggctcaagcgagaggacctcaaccacaccggttctcacaagatcaacaatgccgtcggt
caggtcattcttgccaagcgattgggcaagaaagagctcattgccgagaccggagccggc
cagcacggtgttgctaccgccactgttgccgccaagttcggcatgaagtgcaaggtcttt
atgggtgctgaggacgcccgacgacagtctctcaacgtgttccgtatgcgaatgcttggt
gccgaggttgtcaaggtcgaggagggctccaagactctgcgagacgccgtcaacgaggct
ctgcgattctgggtcaccaacctcgagtcaacccactacgtcattggttctgccattggc
cctcacccctaccccactctggtgcgaactcttcagtccgttattggccgagagaccaag
gagcagtttgctgccctcaacaacggtgctctgcctgatgccgttgtcgcctgtgtcggc
ggtggatccaactcctccggtatgtttgctcccttcgagaacgacaagtctgtgcgactt
gttggtgtcgaggctggaggagacggtattgatacacccgcccactctgctaccctcact
aagggccaggtcggagtgttccagggagtcaagacctacgttctgcagaacgccgatggt
cagatccaggacacacactctatctccgctggtctggactaccccggtgtcggtcctgag
ctgtcctactggaaggatactggccgagttgagtttgttgctgcctccgatgccgacgct
ctcaacgccttccgacagctgacccagctggagggtatcattcccgcccttgagtcgtcg
cacgccatccacggtgccatggagctggccaagaagctgcccaaggacaagaacgtggtc
atctgtctctctggacgaggagacaaggacgtgcagaacgttgctgagcagctgcccaag
ctcggtcccaagattgactgggacctgcgatttgagtaa

DBGET integrated database retrieval system