KEGG   Yarrowia lipolytica: YALI0F27665gHelp
Entry
YALI0F27665g      CDS       T01033                                 

Definition
YALI0F27665p
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
yli  Yarrowia lipolytica
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    YALI0F27665g
Enzymes [BR:yli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     YALI0F27665g
Transfer RNA biogenesis [BR:yli03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    YALI0F27665g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:3511845..3512864
Genome map
AA seq 339 aa AA seqDB search
MSQYSAELKVAKDAVRRASALAASIASTIATDTSGQVTKSDTSPVTVADYGAQAIIIGTI
KKAFPSDPVVGEEDADVLRKDEGLRTKVWDLVKGHRSSSADALDDTNAMLDAIDWGKYEG
GNTGRMWALDPIDGTKGFLRGGQYAVCLALIVDGHVKVGVIGCPNLSTIPTQVATQEKKD
LGVLASAIKDQGAFIEPLSGESDPSPIHFRHLHNTAEATFCESVEAGHSSHSDQAQIAQK
LGITKEGVRMDSQAKYVAVSRGQADIYLRLPVSATYQEKIWDHASGNILVTEAGGTVTDK
DGNALNFGVGRTLKENKGVIVAEKSIFPKVLEAVKQVLG
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatattccgccgaactcaaggtcgccaaggacgctgtgcgacgagccagtgct
ctggctgcttcaatcgcttccaccatcgccacagacacatctggacaggtgaccaaaagc
gacactagtcctgtgactgttgcggactacggagcccaggctatcatcattggaaccatc
aagaaggccttccccagtgatcccgtggttggagaggaggacgccgacgtgcttcgaaag
gacgagggtctacgaaccaaggtgtgggatctggtcaaaggccatcgaagctcctccgcc
gacgccctcgacgacacaaacgctatgctcgacgccattgactggggcaagtacgaggga
ggcaacactggccgaatgtgggctcttgatcccattgatggtaccaagggattccttcga
ggaggtcagtatgccgtttgtcttgctctgattgttgatggccatgtcaaggtcggtgtc
attggatgtcccaatttgagcacgatccccactcaggttgccactcaggaaaaaaaagat
ctgggtgttcttgctagcgccatcaaggaccaaggagctttcattgagcccctcagtggg
gagtcagacccctctcccatccacttccgacacctccacaacactgccgaagctaccttc
tgcgagtctgtcgaggccggccactcttcccattccgatcaggcacagatcgcccagaag
ctcggcatcacaaaggagggcgttcgaatggattcccaggcaaagtacgtggctgtgtcg
cgaggacaggccgacatctatctccgactgcctgtcagcgccacctaccaggagaagatc
tgggaccatgccagtggaaacattcttgttaccgaggccggaggaaccgtcaccgacaag
gacggcaacgctctcaactttggcgtgggccgaaccctcaaggagaacaagggcgtgatt
gtggccgaaaagtccatcttccctaaggtgctggaggctgtcaagcaggttcttggttga

DBGET integrated database retrieval system