KEGG   Yarrowia lipolytica: YALI0F30173gHelp
Entry
YALI0F30173g      CDS       T01033                                 

Definition
YALI0F30173p
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
yli  Yarrowia lipolytica
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    YALI0F30173g
  Replication and repair
   03420 Nucleotide excision repair
    YALI0F30173g
Transcription machinery [BR:yli03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     YALI0F30173g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:3774940..3776343
Genome map
AA seq 467 aa AA seqDB search
MTSQFKNSINDYLEGLPEAVLTRLYQSPATCLAVFRLLPALARTLIMGMIFNPDPIAVAD
VDALVKPSSQRLKLETQKKLRLLHIFTETQAHIIINPTFKKNLRAALVGGDQNISFGVPC
DTEDKHKVDVAFLDAHAVSQWEMILHFMVGTSIGRTPSDGVLNLLKHSGLMEPERGGLRI
TNAGFQFLLQDVNAQIWTLLLQYLNMSEYLQMDPVDVLNFIFMLGSLELGQDYSLSALSE
TQKHMLEDLRDYGIVYQRKASSRRFYPTRLATTLTSETAALRTASQSMEAATQDTISSSV
AADSGFIILETNFRLYAYTESPLQIAVLNLFVNLKTRFANMVTGQINRDSVRFALSNGIT
AEQIITYLSVHAHPRMKGMEHVLPPTVVDQIKLWQLEMDRIRATDGYLFSEFKNFDEYKD
VSTYAKELGVLLYENPGKRKFVSTLAGSQQIVEFVKRRNQKHRSSAN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacgagccagttcaaaaacagcatcaatgactacctggaaggtcttccggaggcagta
ctaactcggctgtaccagtctccggccacatgtctggcggtgttccgactgctacctgct
ctggcaagaacactcatcatgggcatgattttcaaccccgatcccatagcagtagccgac
gtcgacgctctggtgaagccttcaagtcagcgactcaagctcgaaacacagaagaaactg
cgactgctccacattttcacagagacccaggcccatatcatcattaatccgacattcaaa
aagaacctgagggcagctctggtaggaggagaccagaacatttcgtttggagtgccctgc
gacacggaagacaaacacaaggtggatgtggcgtttttggatgctcacgctgtctctcaa
tgggagatgatcttacattttatggtcggaacgtcgattggaagaacacccagtgatgga
gtgctcaacctgctgaagcacagtggacttatggaacccgaacggggaggactgagaatc
accaatgcaggattccagttcttgctacaggatgtaaatgctcagatttggacactgttg
ctccagtatctcaacatgtccgagtatctgcagatggatcctgtagacgtgctcaacttc
attttcatgctaggttctctcgagctaggccaggactactcgctcagtgcactctccgag
acacagaaacacatgctggaggatctgcgggattacggtatcgtctaccagcgaaaagca
tcgtctagacgattctatcctacgcgactggctactactctgacatcagaaacggctgca
cttagaacagccagtcagagcatggaagcagctacacaagacacaatttcgtcttctgtt
gctgccgactctggatttatcattctggaaactaatttcagactctacgcctacacagag
tctccactacagatcgcagtactgaacctttttgtcaatcttaagacacgatttgcaaac
atggttaccggtcagatcaaccgagactcggttcgatttgcgctctcaaacggtattact
gccgaacaaatcatcacatatctctctgttcatgcacacccacgtatgaaggggatggaa
cacgttcttccccctactgtggtggatcagatcaaactgtggcaacttgagatggacaga
atccgagccaccgacggttacttgttctccgagttcaaaaactttgacgagtacaaggat
gtctccacttatgccaaggagctgggcgttctcttgtatgagaatcctggaaagcgaaag
ttcgtgtctacgcttgctggttctcagcagattgttgagtttgtcaaacgacgaaatcaa
aagcaccgtagctccgcaaactga

DBGET integrated database retrieval system