KEGG   Yarrowia lipolytica: YALI0F30305gHelp
Entry
YALI0F30305g      CDS       T01033                                 

Definition
YALI0F30305p
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
yli  Yarrowia lipolytica
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:yli00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    YALI0F30305g
Translation factors [BR:yli03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    YALI0F30305g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:complement(3788963..3789691)
Genome map
AA seq 242 aa AA seqDB search
MASWDDEDFEVPAAATPAVPANWDDDEEEDVMDSWDAEEPTKAPGPKTTVAAPKKAQRQQ
IAKIEREMAAMKLKPEDASTKRDRQRQAELDSDMMNASELFGGTGGIADSAAKAEAAPAP
AAPAAPMKLSDLAIFHPKEKKDFTNLKETLAPILTDLNKTSPLAYPDFAITFTKALAEPL
KVEQLRKLISTLNAYQNEKIREEKAARGKKKKPGLAAASAKINDDKDTSTFNDNFDDFDD
FM
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggccagctgggacgacgaagactttgaggtgcctgccgctgccacccccgcagtcccc
gccaactgggatgacgacgaagaggaggacgtcatggactcctgggatgctgaggagccc
accaaggcacccggacccaagaccaccgtggctgcccccaagaaggcccagcgacagcag
atcgccaagatcgagcgagagatggctgccatgaagctcaagcctgaggatgcttccacc
aagcgagaccgacagcgacaggccgagctcgactccgacatgatgaacgcttctgagctg
tttggtggcactggaggtattgctgacagcgctgcaaaggctgaggccgctcctgctccc
gctgcccctgccgctcccatgaagttgtcggatctggcaatcttccaccccaaggagaag
aaggacttcaccaacctcaaggagactctggcccccatcctcacagaccttaacaagacc
agcccactggcctaccccgactttgccatcaccttcaccaaggctctggctgagcccctc
aaggtcgagcagctccgaaagctcatctctaccctgaacgcttaccagaatgagaagatt
cgagaggagaaggctgctcgaggtaagaagaagaagcccggtcttgctgctgcctccgcc
aagatcaatgacgataaggatacttctaccttcaacgacaacttcgatgattttgacgat
ttcatgtaa

DBGET integrated database retrieval system