KEGG   Yarrowia lipolytica: YALI0F31427gHelp
Entry
YALI0F31427g      CDS       T01033                                 

Definition
YALI0F31427p
Orthology
K00273  
D-amino-acid oxidase [EC:1.4.3.3]
Organism
yli  Yarrowia lipolytica
Pathway
Glycine, serine and threonine metabolism
Penicillin and cephalosporin biosynthesis
Arginine and proline metabolism
D-Arginine and D-ornithine metabolism
Metabolic pathways
Peroxisome
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:yli00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:yli00330]
Metabolism; Metabolism of other amino acids; D-Arginine and D-ornithine metabolism [PATH:yli00472]
Metabolism; Biosynthesis of other secondary metabolites; Penicillin and cephalosporin biosynthesis [PATH:yli00311]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:yli04146]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:join(3906546..3906574,3906652..3907684)
Genome map
AA seq 353 aa AA seqDB search
MAKKNYVVIGSGIAGLTTALTLSKKPNTNVTIVAKHLPGDLSIDFTSPWAGGDWDSFAKK
DEITLQNYDKPAYLEFLRLSREVPEAGIWIRQVTIYFHDRDIPKKKDGSLDTDAVTPWYS
TFVEGWRTLRKEELPERVVWGYTFTSVVISTTRYMFYVQQECVKRGVQFRRATLKHVCDA
KKYTAFPGPVDAVFNCSGLSAKFLGGVEDSNMYPILGQTLLVRNRTERLLTYVSVDGYED
ECLYIMPRAEGGTVLGGCMRVNDWSTEPDKALADRIVARATKACPELLDDGPLDVVSHNV
GRRPARQGGPRVEKETIDGTVVIHNYGAGPAGFQSSIGMAEAAVDLLKGSSKL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagaattatgtggtgattggatctggcattgcaggactcactactgctctg
accctgtccaagaaacccaataccaatgtgaccatcgttgccaaacatctgcctggcgat
ctctcaattgatttcacatcaccctgggctggaggagactgggactcgtttgccaagaag
gacgagatcacgcttcaaaactacgacaagcctgcgtacctggagtttctgcggctctca
cgagaagttccagaggctggaatctggatccgacaggttactatttatttccacgacaga
gatattcccaagaagaaggacggatctctcgataccgacgccgtgactccctggtatagc
acctttgtggagggttggagaactcttcgaaaggaggagctccctgagagagtggtctgg
ggctacacattcacatctgtggtaatttccactactcgatacatgttttatgtacagcag
gaatgcgtcaagcggggcgtacagttccgaagagctactcttaagcatgtctgtgatgcc
aaaaagtacactgccttccctggaccagtagacgccgtgttcaactgctcgggactatct
gccaagtttctgggaggtgtggaggactctaacatgtaccccattctcggccagactctg
ctggttcgaaacaggaccgagagactgctcacgtatgtgtccgtggatggctacgaagac
gagtgtctgtacatcatgcctagagccgaaggaggcacagttctgggcggatgtatgcga
gtcaacgactggtccactgaacctgataaggctctggcagaccgaattgttgcccgagca
actaaggcctgtcctgagctgctggatgacggtcctctggatgttgtttctcacaatgtt
ggtcgacggccagctcgacagggcggtcctcgagttgagaaggagaccattgacggaact
gtcgtcatccataattacggagccggtcccgctggtttccagagcagtatcggtatggcc
gaggcagctgttgatctcttgaaggggtcaagtaagttgtaa

DBGET integrated database retrieval system