KEGG   Yarrowia lipolytica: YALI0F31427gHelp
Entry
YALI0F31427g      CDS       T01033                                 

Definition
(RefSeq) YALI0F31427p
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
yli  Yarrowia lipolytica
Pathway
yli00260  Glycine, serine and threonine metabolism
yli00311  Penicillin and cephalosporin biosynthesis
yli00330  Arginine and proline metabolism
yli00472  D-Arginine and D-ornithine metabolism
yli01100  Metabolic pathways
yli01130  Biosynthesis of antibiotics
yli04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YALI0F31427g
   00330 Arginine and proline metabolism
    YALI0F31427g
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    YALI0F31427g
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    YALI0F31427g
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    YALI0F31427g
Enzymes [BR:yli01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     YALI0F31427g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 Thi4 Lycopene_cycl Pyr_redox_3 NAD_binding_7 HI0933_like
Motif
Other DBs
NCBI-GeneID: 2907946
NCBI-ProteinID: XP_506095
UniProt: Q6BZR7
Position
F:join(3906546..3906574,3906652..3907684)
Genome map
AA seq 353 aa AA seqDB search
MAKKNYVVIGSGIAGLTTALTLSKKPNTNVTIVAKHLPGDLSIDFTSPWAGGDWDSFAKK
DEITLQNYDKPAYLEFLRLSREVPEAGIWIRQVTIYFHDRDIPKKKDGSLDTDAVTPWYS
TFVEGWRTLRKEELPERVVWGYTFTSVVISTTRYMFYVQQECVKRGVQFRRATLKHVCDA
KKYTAFPGPVDAVFNCSGLSAKFLGGVEDSNMYPILGQTLLVRNRTERLLTYVSVDGYED
ECLYIMPRAEGGTVLGGCMRVNDWSTEPDKALADRIVARATKACPELLDDGPLDVVSHNV
GRRPARQGGPRVEKETIDGTVVIHNYGAGPAGFQSSIGMAEAAVDLLKGSSKL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggccaagaagaattatgtggtgattggatctggcattgcaggactcactactgctctg
accctgtccaagaaacccaataccaatgtgaccatcgttgccaaacatctgcctggcgat
ctctcaattgatttcacatcaccctgggctggaggagactgggactcgtttgccaagaag
gacgagatcacgcttcaaaactacgacaagcctgcgtacctggagtttctgcggctctca
cgagaagttccagaggctggaatctggatccgacaggttactatttatttccacgacaga
gatattcccaagaagaaggacggatctctcgataccgacgccgtgactccctggtatagc
acctttgtggagggttggagaactcttcgaaaggaggagctccctgagagagtggtctgg
ggctacacattcacatctgtggtaatttccactactcgatacatgttttatgtacagcag
gaatgcgtcaagcggggcgtacagttccgaagagctactcttaagcatgtctgtgatgcc
aaaaagtacactgccttccctggaccagtagacgccgtgttcaactgctcgggactatct
gccaagtttctgggaggtgtggaggactctaacatgtaccccattctcggccagactctg
ctggttcgaaacaggaccgagagactgctcacgtatgtgtccgtggatggctacgaagac
gagtgtctgtacatcatgcctagagccgaaggaggcacagttctgggcggatgtatgcga
gtcaacgactggtccactgaacctgataaggctctggcagaccgaattgttgcccgagca
actaaggcctgtcctgagctgctggatgacggtcctctggatgttgtttctcacaatgtt
ggtcgacggccagctcgacagggcggtcctcgagttgagaaggagaccattgacggaact
gtcgtcatccataattacggagccggtcccgctggtttccagagcagtatcggtatggcc
gaggcagctgttgatctcttgaaggggtcaagtaagttgtaa

DBGET integrated database retrieval system