KEGG   Yarrowia lipolytica: YALI0F31999gHelp
Entry
YALI0F31999g      CDS       T01033                                 

Definition
YALI0F31999p
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
yli  Yarrowia lipolytica
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:yli00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YALI0F31999g
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    YALI0F31999g
Enzymes [BR:yli01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     YALI0F31999g
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Bordeaux: 
UniProt: 
Position
F:3962550..3964247
Genome map
AA seq 565 aa AA seqDB search
MLRTRFINSVNSARAMSRNINTLSQFPYPTLQQEESFFKSQVEDIEKWWASPRYEGIKRP
YTAEKVAIHRGTLPQTYASSVQAEKLFNIFTERGKQGLPVHTTGSVDPVQMTQSAPHQEV
VYISGWACSSLLTTTNEVSPDFGDYPYDTVPNQVDRIFRAQGLHDKKAWHEWMSLSHEER
VKRDQEGKGRIDYLRPIIADADTGHGGLSAVMKLAKLFAERGAAAIHLEDQLHGGKKCGH
LAGKVIVPTGSHISRLNATRMQWDIMGCSNLVIARTDSESAKLLSSAADPSDHEYILGVV
KPIKPLAEVLLTAEANGATADMVNKLELEWTKEAEMMTYDEAVQRALTEAGKSDKIEEYL
TKAKGKSNFEARQIADELAGKHIFFDWDAPKTREGHYHVQCGIEPAIKRALAFAPYADLI
WLETKTPDLAQAQAFAKRIREKFPGKWLVYNLSPSFNWSAHGYSDEQLKSFVWDLAKSGF
VMQLISLAGLHSNAVATHELSTRFKTEGMKAYVDLVQRKEKELGCDVLTHQKWSGANYLD
SIISTVQSGSSGTSSTGGDSTENQF
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaacacgattcatcaacagcgtcaacagcgcacgagcaatgtctcgaaacatc
aacaccctgtcgcaattcccttaccccacccttcagcaagaggagagcttcttcaagagc
caggtcgaggacattgaaaagtggtgggcctctcctagatatgagggcatcaagcgaccc
tacaccgccgagaaggtggccatccaccgaggtactctcccccagacctacgcatcttcc
gtccaggccgagaagctcttcaacatcttcaccgagcgaggcaagcagggtcttcctgtc
cacacaaccggttctgtcgaccccgtccagatgacacagagcgcacctcatcaggaggtg
gtttacatttccggctgggcctgttcgtccctgttgactaccaccaacgaggtgtcacct
gatttcggagactacccttacgacaccgttcccaaccaggttgatcgaatcttccgagcc
cagggtcttcacgacaagaaggcgtggcacgagtggatgtctctgtcccacgaggagcga
gtcaagcgagaccaggagggcaagggccgaatcgattacctgcgacccatcattgccgac
gctgacaccggccacggcggtctgtctgccgttatgaagctggccaagctttttgccgag
cgaggcgctgctgccatccatctcgaggaccagctgcacggcggtaagaagtgcggtcac
cttgctggcaaggtcattgtgcccaccggctctcacatttcccgactcaatgccacccga
atgcaatgggacatcatgggctgctccaacctggtgattgcccgaaccgattccgagtct
gccaagctgctttcttctgctgccgatccctccgaccacgagtacatcctcggtgtcgtc
aagcccatcaagcccctggccgaggtcctcctcaccgccgaggccaacggcgccactgcc
gatatggtcaacaagctcgagctcgagtggaccaaggaggccgagatgatgacctacgac
gaggccgtgcagcgagccctgaccgaggccggcaagtccgacaagatcgaggagtacctg
accaaggccaagggcaagtccaactttgaggcccgacagattgccgacgagctggccggc
aagcacattttcttcgactgggacgctcccaagacccgggagggccactaccatgtccag
tgcggcattgagcctgccatcaagcgagctctggcctttgctccttacgccgatctcatc
tggctcgagaccaagacccccgaccttgcccaggcccaggcctttgccaagcgaatccga
gagaagttccccggcaagtggctggtgtacaacctgtcaccttccttcaactggtctgcc
catggctactccgacgagcagctgaagtcgtttgtgtgggacctggccaagtctggcttt
gtcatgcagctcatctctctggccggcctgcactccaacgccgtcgccacccatgagctc
tccacccgattcaagaccgagggaatgaaggcatacgtggaccttgtccagcgaaaggag
aaggagcttggatgtgacgtcctgacccaccagaagtggtccggtgccaactacctggac
tccatcatctccactgtccagtccggatcttccggcacctcttccaccggtggcgactcc
accgagaaccagttttaa

DBGET integrated database retrieval system