KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0017Help
Entry
YPA_0017          CDS       T00369                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:ypa01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ypa00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:ypa00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
21701..23299
Genome map
AA seq 532 aa AA seqDB search
MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLATRASWQQTIDQG
ALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGLHLPEKHVKWQD
EAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFNFTEQRFGLSQG
TIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVRADKELEASNGH
DGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCSGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSNGQTVTKELFRS
MLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacagttagcgggcacagagttagttttcacccagccttttaatgctgctgag
cggcaggttttaccggataaagccatcgagtttctaaccgaattagtggtgaaatttagc
gaatcgcgtaaccaactccttgccacaagggcatcttggcagcaaaccatcgatcagggg
gcgttacccgattttattttggaaactaattccattcgtgatggtgattggaaaatccaa
ggtattcctgctgacttacgcgatcgtagagttgagatcaccgggccagtagagcggaaa
atggtgatcaatgcgcttaatgccaacgtaaaagtttttatggcggatttcgaagattca
ctggcacccagttgggataaagtgattgatggtcaaattaatctacatgatgcggtgaaa
gggacaatttcctatacgaatgaatcgggcaaggtctatcaattaaaacctaatcccgcg
gtattgattgcacgtgttcgtggcctgcacttaccggaaaaacatgttaaatggcaggac
gaggcgattcccggtggtttattcgatttcgctttgtatttctaccataactatcagcaa
ctgctggcgaagggcagcggcccttatttctatttgccgaagatgcagtcataccaggaa
gccgcttggtggagcgatgtgttcaattttaccgagcagcgctttggtctatcgcagggc
accattaaggcgacggtattaattgagacattacccgccgttttccaaatggatgaaatt
ctctaccacctgcgccaccacattgttggtctgaattgtgggcgctgggactatatcttt
agctatataaaaacattgaaaaaccaccctgaccgcgtgttaccagatcgccagtcagtc
acgatgaataaaccttttcttagcgcgtattcccgtttgttgatcaagacatgccataaa
cgtggcgctttggcgatggggggaatggccgccttcatcccggataaagacgcagaaaag
aataagttggtgttggataaagttcgtgccgacaaagagttagaagccagtaacggccac
gatggaacttgggtggcgcatccgggcttggcagatacggtgatggacgtttttaacaaa
gtattaggttctcggcctaatcaattagaggttagccgcgaacaggataaacctatcacc
gccgctgagttgctggaaccttgttctggcgagcgcactgaagcagggatgcgggccaat
atcagagtcgcggtgcagtacattgaagcatggatatcgggtaatggttgtgtgccgatt
tatggcttgatggaggatgcggctactgcagagatttcccgcacttctatctggcaatgg
atacatcatcagaaaagcctcagtaatggccagacggtgactaaagagctgttccgcagc
atgttgagtgaagaaattcaggttgtgaagcttgagcttggcgcagagcgttttgatcgc
gggcggtttgaagaagctgcacgcttgatggagcgtattacaacacaagacgagcttatc
gacttcctgacgttgccgggctatgcattgcttgcctga

DBGET integrated database retrieval system