KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0017Help
Entry
YPA_0017          CDS       T00369                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    YPA_0017
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    YPA_0017
   00630 Glyoxylate and dicarboxylate metabolism
    YPA_0017
Enzymes [BR:ypa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     YPA_0017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
21701..23299
Genome map
AA seq 532 aa AA seqDB search
MRQQLAGTELVFTQPFNAAERQVLPDKAIEFLTELVVKFSESRNQLLATRASWQQTIDQG
ALPDFILETNSIRDGDWKIQGIPADLRDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWDKVIDGQINLHDAVKGTISYTNESGKVYQLKPNPAVLIARVRGLHLPEKHVKWQD
EAIPGGLFDFALYFYHNYQQLLAKGSGPYFYLPKMQSYQEAAWWSDVFNFTEQRFGLSQG
TIKATVLIETLPAVFQMDEILYHLRHHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMNKPFLSAYSRLLIKTCHKRGALAMGGMAAFIPDKDAEKNKLVLDKVRADKELEASNGH
DGTWVAHPGLADTVMDVFNKVLGSRPNQLEVSREQDKPITAAELLEPCSGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKSLSNGQTVTKELFRS
MLSEEIQVVKLELGAERFDRGRFEEAARLMERITTQDELIDFLTLPGYALLA
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgagacaacagttagcgggcacagagttagttttcacccagccttttaatgctgctgag
cggcaggttttaccggataaagccatcgagtttctaaccgaattagtggtgaaatttagc
gaatcgcgtaaccaactccttgccacaagggcatcttggcagcaaaccatcgatcagggg
gcgttacccgattttattttggaaactaattccattcgtgatggtgattggaaaatccaa
ggtattcctgctgacttacgcgatcgtagagttgagatcaccgggccagtagagcggaaa
atggtgatcaatgcgcttaatgccaacgtaaaagtttttatggcggatttcgaagattca
ctggcacccagttgggataaagtgattgatggtcaaattaatctacatgatgcggtgaaa
gggacaatttcctatacgaatgaatcgggcaaggtctatcaattaaaacctaatcccgcg
gtattgattgcacgtgttcgtggcctgcacttaccggaaaaacatgttaaatggcaggac
gaggcgattcccggtggtttattcgatttcgctttgtatttctaccataactatcagcaa
ctgctggcgaagggcagcggcccttatttctatttgccgaagatgcagtcataccaggaa
gccgcttggtggagcgatgtgttcaattttaccgagcagcgctttggtctatcgcagggc
accattaaggcgacggtattaattgagacattacccgccgttttccaaatggatgaaatt
ctctaccacctgcgccaccacattgttggtctgaattgtgggcgctgggactatatcttt
agctatataaaaacattgaaaaaccaccctgaccgcgtgttaccagatcgccagtcagtc
acgatgaataaaccttttcttagcgcgtattcccgtttgttgatcaagacatgccataaa
cgtggcgctttggcgatggggggaatggccgccttcatcccggataaagacgcagaaaag
aataagttggtgttggataaagttcgtgccgacaaagagttagaagccagtaacggccac
gatggaacttgggtggcgcatccgggcttggcagatacggtgatggacgtttttaacaaa
gtattaggttctcggcctaatcaattagaggttagccgcgaacaggataaacctatcacc
gccgctgagttgctggaaccttgttctggcgagcgcactgaagcagggatgcgggccaat
atcagagtcgcggtgcagtacattgaagcatggatatcgggtaatggttgtgtgccgatt
tatggcttgatggaggatgcggctactgcagagatttcccgcacttctatctggcaatgg
atacatcatcagaaaagcctcagtaatggccagacggtgactaaagagctgttccgcagc
atgttgagtgaagaaattcaggttgtgaagcttgagcttggcgcagagcgttttgatcgc
gggcggtttgaagaagctgcacgcttgatggagcgtattacaacacaagacgagcttatc
gacttcctgacgttgccgggctatgcattgcttgcctga

DBGET integrated database retrieval system