KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0051Help
Entry
YPA_0051          CDS       T00369                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(67150..67983)
Genome map
AA seq 277 aa AA seqDB search
MHLTARGLTLDLSRPQVMGILNVTPDSFSDGGCHNNLDQALQHAQRMLSAGATLIDIGGE
STRPGAAEVSEQEELDRVVPVVEALAQRFDVWLSVDTSKAAVITESAHAGAHLINDIRSL
QEPGALEAAAKTGLPVCLMHMQGQPKNMQHSPYYDDLMTDINRFFQHHIERCVAAGIAKN
KLLLDPGFGFGKNLAHNYQLLAHLSELHHFELPLLVGMSRKSMVGQLLNVPPQQRVIGSV
ACAVIAAMQGAQIIRVHDVKETVEAMCIVEATRSAKG
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgcatctaactgccagaggtctgacgttggatctctctcgtccacaagtcatgggtatt
ctgaatgtcacaccagattcattttcagatggtgggtgtcacaataaccttgatcaagca
ttgcaacatgctcaacggatgttatcagcaggcgctacgctgattgatatcggtggtgaa
tcaacgcgccctggggctgctgaagtcagtgagcaagaagaacttgatcgagtcgtgcct
gtggttgaggcgttagctcagcgttttgatgtgtggctctcggtagacacgtctaaagcc
gctgttatcactgaatctgctcatgcaggtgcccatctaattaatgatatccgctcgttg
caagagcctggcgctcttgaagcagcggcaaagactggcttaccggtgtgcctaatgcat
atgcaggggcaaccgaaaaatatgcagcattcaccctactatgatgatttaatgaccgat
ataaatcggttcttccaacatcatattgaacgctgtgttgcggcaggtatcgcaaaaaat
aaattgttgctcgacccaggcttcggtttcggtaaaaatctggcgcataattaccaacta
ttggcacatctgtcagagcttcaccattttgagttgccattattggtcggaatgtcgaga
aaatcgatggtaggccaattattgaatgtaccaccacaacagcgtgtcatcgggagtgtt
gcttgtgcggtgattgctgccatgcaaggtgcgcagattatcagagtgcatgatgtcaaa
gaaactgtcgaggcgatgtgtatcgtcgaggcaacacgttcagcgaagggataa

DBGET integrated database retrieval system