KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0588Help
Entry
YPA_0588          CDS       T00369                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00020  Citrate cycle (TCA cycle)
ypa00190  Oxidative phosphorylation
ypa00650  Butanoate metabolism
ypa01100  Metabolic pathways
ypa01110  Biosynthesis of secondary metabolites
ypa01120  Microbial metabolism in diverse environments
ypa01130  Biosynthesis of antibiotics
ypa01200  Carbon metabolism
Module
ypa_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ypa_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ypa_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    YPA_0588
   00650 Butanoate metabolism
    YPA_0588
  Energy metabolism
   00190 Oxidative phosphorylation
    YPA_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ABG12556
JGI: YPA0588
UniProt: A0A0E1NUR8
Position
670507..670854
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVITLYVFYILGFVVIVPDITYEIWRGFFASHITKVF
TLLTLLSILAHAWIGLWQVLTDYIKPLAIRLVLQLVVVITLLVYLLYGTIVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcttctgcgttagggcgtaatggagtacacgattggttgttactgcgt
gcttctgcaatcgtcatcaccctgtatgtcttttatattctgggcttcgttgtgattgtc
ccagacatcacctatgaaatctggcgcggtttcttcgcgtcacacatcacaaaagtattt
acgctgctgacattgctgtcgattctagctcacgcttggatcggtctatggcaggtattg
acggactatataaagccactggcgatacgactggtgttacaactggtcgtcgtgattacg
ctgttggtttatttattgtatggaacaattgtggtgtggggagcttaa

DBGET integrated database retrieval system