KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0800Help
Entry
YPA_0800          CDS       T00369                                 

Definition
(GenBank) GTP cyclohydrolase
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00790  Folate biosynthesis
ypa01100  Metabolic pathways
Module
ypa_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    YPA_0800
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     YPA_0800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: ABG12768
JGI: YPA0800
UniProt: A0A0H2Y4U1
Structure
PDB: 

Jmol
Position
922496..923200
Genome map
AA seq 234 aa AA seqDB search
MLVLSGCVSLLEKRMSSLSKEAELVHQALLARGLETPLRKPELDAETRKTRIQAHMTEVM
HLLNLDLTDDSLADTPRRIAKMYVDEIFSGLDYENFPKITLIQNKMKVDEMVTVRDITLT
STCEHHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERLTQQILLALQTLLG
TNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHG
NT seq 705 nt NT seq  +upstreamnt  +downstreamnt
atgcttgtcttatctggatgcgtaagcctgttggagaaaagaatgtcatcgctaagtaaa
gaagctgagttggttcatcaagcgctgctggcccgtggtcttgaaacccctttacgtaaa
ccagaattagatgccgagacgcgcaaaactcggattcaggcccatatgacagaagtcatg
catttgctgaatcttgatttaaccgacgatagtctggctgatacaccaagacgcattgcg
aagatgtatgttgatgagattttctccggattggattacgaaaatttccctaaaatcaca
ctgattcaaaataaaatgaaagttgatgaaatggtaacggtacgggatatcactctgacc
agcacctgcgaacatcattttgtgacgattgatgggaaagccaccgtcgcttatattccg
aaagacagtgtcattggtttgtcgaaaatcaaccgtatcgtgcagttttttgcgcagcgt
ccgcaagtgcaggaacgattaacacagcagatcttgctcgcattacaaaccctgttgggt
accaataatgtcgcagtttctattgatgcagttcattattgcgttaaagcacgtggtatc
cgtgatgcgaccagcgcgacgaccaccacatcattaggcgggttatttaaatccagtcag
aatacgcgtcaggaatttctgcgtgcggttcgtcaccacggctga

DBGET integrated database retrieval system