KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0834Help
Entry
YPA_0834          CDS       T00369                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00040  Pentose and glucuronate interconversions
ypa00052  Galactose metabolism
ypa00500  Starch and sucrose metabolism
ypa00520  Amino sugar and nucleotide sugar metabolism
ypa01100  Metabolic pathways
ypa01130  Biosynthesis of antibiotics
Module
ypa_M00362  Nucleotide sugar biosynthesis, prokaryotes
ypa_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    YPA_0834
   00052 Galactose metabolism
    YPA_0834
   00500 Starch and sucrose metabolism
    YPA_0834
   00520 Amino sugar and nucleotide sugar metabolism
    YPA_0834
Enzymes [BR:ypa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     YPA_0834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABG12802
JGI: YPA0834
UniProt: A0A0E1NW10
Position
965948..966838
Genome map
AA seq 296 aa AA seqDB search
MKCLKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYIVDECVAAGVKEIVLVSHSSK
NAIENHFDTSFELEAALESRVKRQLLKEIKNICPADVTIMQVRQGHAKGLGHAVLCAKSM
VGDNPFIVMLPDVLLDDSTADLSKENLASMIKRFEETGHSQIMVEPVPKADVSKYGIADC
GHVALAPGESTLMTAVVEKPSIAEAPSNLAVVGRYVLSKNIWPLLEKTPRGAGDEIQLTD
AIAMLMQQEPVEAFHMTGKSHDCGDKLGYMKAFVTYGVRHHTEGEKFTAWLKQQLD
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgtttaaaagccgtcattcctgttgctgggcttggcacccgtatgttgcccgcg
actaaagctattccgaaagaaatgctcccggtcgtcgataaacccctgatccagtatatt
gtggatgaatgtgttgccgcaggggtcaaagagatcgtactggtgagccattcatctaag
aatgcgatagagaatcattttgatacttcatttgagctggaagccgcgctggagtcacgg
gttaagcggcagttattaaaagagatcaaaaatatttgcccagcggatgtcaccattatg
caagtgcggcagggccatgctaaaggtctagggcacgcagtgttatgtgctaaatcgatg
gtgggggacaatccttttatcgtcatgctaccggatgtactactggacgattcaacggct
gatttatcaaaagaaaatcttgccagtatgattaaacgcttcgaagaaaccggtcatagc
caaatcatggttgagccagtgcccaaagcggatgtctccaaatacggtattgcggattgt
ggccatgtggcattagcaccaggcgaaagcacgttgatgacagcggtggtagaaaaaccc
tctatagccgaggccccgtctaaccttgctgtagttgggcgctatgtattgtctaaaaat
atctggccgttgcttgagaaaacaccacgtggtgcgggggatgaaattcaactgaccgat
gccattgcgatgttaatgcagcaagagcccgtagaggcatttcatatgacgggcaaatct
catgattgcggcgataaactgggctatatgaaagcttttgtgacttatggcgttcgtcat
catactgaaggtgaaaagtttactgcctggctaaaacagcaactcgattaa

DBGET integrated database retrieval system