KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_0969Help
Entry
YPA_0969          CDS       T00369                                 

Definition
6-phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ypa00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1114230..1115666
Genome map
AA seq 478 aa AA seqDB search
MSYQQLPKDFLWGGAVAAHQVEGGWDKGGKGVSIADVLSGGSHGVDRVMTDGVLEGYRYP
NHEAVDFYSHYKEDIALFAEMGFKCFRTSIAWTRIFPHGDEQQPNEAGLQFYDDMFDELL
KYGIEPVITLSHFEMPWHLVKEYGGWKNRKVVDFFVKFSEVVMARYKSKVKYWMTFNEIN
NQRNWKYPLFGYCCSGVVFTEQENPEETLYQVLHHQFVASAKVVKLGHAINPEFKIGCMV
AMVPLYPFSCHPDDMMYSVEAMRERYLFGDVHMRGYYPSYILQEWARRGFNIHMEEGDLE
TLRDGCADYMGLSYYMSNAVSAINPGSGNSLSGFEGSVPNPHVKASDWGWQIDPVGLRYS
LSVLYERYQKPLFIVENGFGAIDKVAADGMVHDDYRIAYLKAHIEQMKKAVFEDGVDLMG
YTPWGCIDCVSFTTGEYSKRYGFIYVDKNDDGTGTMARSRKLSFDWYKKVIASNGEVL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagctatcaacagttaccgaaagattttttatggggtggcgcggttgcggcacatcag
gttgaaggcggctgggataaaggcggcaaaggcgtgagcattgctgatgtcctctctggt
ggctcccatggggttgaccgtgtgatgacagacggagtactggaagggtatcgttatcca
aaccatgaagcagttgatttttatagccattacaaagaagacatcgcgctgtttgccgaa
atgggcttcaaatgtttccgcacctcaattgcctggactcgtatcttcccgcatggcgat
gaacagcaacccaatgaagccggcctgcaattttatgacgatatgttcgatgaattgctg
aaatacggtattgaaccggtgattacgttatctcacttcgaaatgccgtggcatctggtc
aaagaatatggtggctggaaaaaccgtaaagtggtcgatttctttgtaaaattcagtgaa
gtcgtcatggcgcgctacaaaagcaaagttaaatattggatgaccttcaacgagataaat
aaccagcgtaactggaaatatccactgtttggttattgctgttctggtgtggtgttcact
gaacaagagaacccagaagagaccctgtatcaggtactgcatcatcagtttgttgccagt
gccaaagtggtcaagctgggtcatgccattaatccggaatttaagattggctgtatggtg
gcgatggtgcctctgtatcctttctcctgccatccagatgacatgatgtattccgttgaa
gctatgcgtgagcgttatcttttcggcgacgttcatatgcgcggttattacccttcatat
attttacaagagtgggcgcgccgtggtttcaatatccatatggaagagggggacctcgag
actctgcgtgatggttgcgccgattacatggggctgagttattacatgagtaacgcggtc
tctgcgattaatccaggtagcggcaattcactctctggttttgagggcagcgtgccgaac
ccacacgtcaaagcctctgattgggggtggcagattgatccggtaggtctgcgttactct
ctgagtgtgttgtatgaacgctatcagaagccgctatttattgttgaaaatggttttggt
gcgatagataaagtggcagcggatggcatggtgcacgacgactaccgcattgcttatcta
aaagcccatatcgagcagatgaaaaaagcggtatttgaagatggcgtggatctaatgggt
tataccccatggggatgtattgactgcgtatctttcactaccggtgaatacagtaaacgt
tatggctttatttatgtcgataaaaacgatgatggcaccggtacaatggcgcgttcacgt
aagttaagttttgattggtataaaaaagttattgccagcaatggtgaagttctttaa

DBGET integrated database retrieval system