KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1043Help
Entry
YPA_1043          CDS       T00369                                 

Definition
(GenBank) aldose 1-epimerase (EC:5.1.3.3)
  KO
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Module
Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPA_1043
   00052 Galactose metabolism
    YPA_1043
Enzymes [BR:ypa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     YPA_1043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
JGI: 
Position
complement(1195018..1195914)
Genome map
AA seq 298 aa AA seqDB search
MLLGYPTPADYLHQAAYLGATVGRYANRIANAQITLDGETIQLVPNQGPNQLHGGPEGFH
AQRWQKVTQDDHQVTYKLDSPDGDQGFPGNLTVEVQYLLTEDNRLEIHYQAQVDKTCPVN
LTNHAYFNLDGEGHDARSHRLQLFADRYLPVDSAGIPTGGLADVENTGMDFRQPKTLAQD
FLQDRCQQRVKGYDHAYLLHRTCGALDSPAAHLWSSDNQVQMSMFTSAPALQLYSGNYLA
GTPARNGGTYASYAGVALESEFLPDSPNHPEWPQPDCWLKPGKTYRSTTVYHFIALPL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
ttgctactgggctacccgacaccggctgattacctgcatcaagccgcttatctcggggcc
acggttggccgttatgccaaccggatagccaatgcgcaaatcaccttggatggcgaaaca
atccagttggtcccgaaccaaggccctaaccaattacacggtggcccggaaggtttccat
gcccagcgttggcagaaagtgacccaagatgaccaccaggttacctataaacttgattca
ccagatggcgatcaaggtttccccggtaatctgactgttgaagtacagtacctgctaacc
gaagataaccggctggaaattcattatcaggcacaggtggataaaacctgcccggttaac
ctgaccaatcatgcctatttcaaccttgacggcgaagggcatgatgcccgttcacatcgt
ttgcaactgtttgcagaccgttacctgcctgtcgacagtgcgggcatcccaaccggagga
ctcgctgatgtcgagaataccggtatggattttcgccaacctaaaacattggcgcaggat
tttctacaagatcgctgccagcaacgagttaaaggctatgaccacgcttatttgctgcac
cgcacctgtggggccttagactctccggcggcacacttgtggtcatccgataaccaggtg
caaatgagtatgttcacctcagcgcctgcgttgcagctttacagcggaaattatcttgct
ggcacacccgcacgcaacggcggcacctatgccagctatgcgggtgtggcactagaaagt
gaatttttgcctgatagccctaaccaccctgaatggccacagcccgattgttggctaaaa
ccggggaagacctatcgctcaacgacggtttatcactttattgcgttgcctttataa

DBGET integrated database retrieval system