KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1322Help
Entry
YPA_1322          CDS       T00369                                 

Definition
(GenBank) L-glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00220  Arginine biosynthesis
ypa00250  Alanine, aspartate and glutamate metabolism
ypa00471  D-Glutamine and D-glutamate metabolism
ypa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    YPA_1322
   00220 Arginine biosynthesis
    YPA_1322
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    YPA_1322
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     YPA_1322
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABG13289
JGI: YPA1322
UniProt: A0A0E1NZS8
Position
1483692..1484699
Genome map
AA seq 335 aa AA seqDB search
MPTDDSNNGIIDYVSTGHLPDPETVVKLVQEAHKRFSTDTAGVVSNVYPALERIPADLFG
ICMVGTNGKIHSAGDVDYEFTIMSVSKPFVFALVCQAIGAKTAREKLGVNSTGMAFNSVT
AIERASDGRTNPMVNSGAIATTSLVPGATSDEQWKFIYDGLCRFAGRELTLNEEVYQSAC
ETNFRNRGIANVLQGYGRLGCDPIIATDLYTRQCSLNVSARDLAVMGATLADGGVNPLTR
ERVVDNDICHYALAVMVTAGLYETSGDWLYDIGLPGKSGIGGGIVTVSPGKGGLGTFAPL
LDSAGNSIKGQLAARFLSRSLGMDMFVSEPYTEKN
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgccgacagatgatagcaataacggaattatcgactacgtatcaacaggtcatctacct
gacccggaaacagtcgttaaattagtgcaagaagcccataagcgatttagtacggatact
gctggtgtggtttctaatgtttatccggcattagagagaattcctgctgatctctttggc
atttgcatggttggcactaacggcaaaatccactctgctggcgatgtggattatgaattt
accattatgagtgtttccaaacccttcgtttttgcactggtttgtcaggctattggggcg
aagaccgcccgtgaaaaactcggggttaacagtaccggtatggcgtttaactcggtaacg
gccattgagcgggcatcggatggccgtacaaatccaatggttaactcgggtgcgattgcg
acgaccagtctggttcctggcgcgaccagtgatgaacaatggaaattcatttatgacggt
ttgtgccgctttgctggccgcgaattaacactgaatgaagaagtataccaatcggcttgt
gaaaccaatttccgtaatcgcggtatcgctaatgtgctgcaaggttatgggcgtctgggg
tgtgatcctattatcgccactgatctctatacccgccagtgttcactgaatgtcagtgcc
cgagatctggctgtgatgggcgcgacattagcggacggcggcgttaacccactgactcgt
gagcgagtggtggacaatgatatctgccattatgcattagccgtcatggtaacggcaggg
ctgtatgagacctctggagactggctctacgatattggcctgcccggtaaaagcggcatt
ggcggtggaattgtgacagtgtcacctggcaagggagggttggggacgttcgcaccgtta
ctcgacagtgcgggtaacagtatcaaagggcaacttgctgctcggttcttatcacgcagt
ctcgggatggatatgttcgtttctgagccttacaccgaaaagaattga

DBGET integrated database retrieval system