KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1513Help
Entry
YPA_1513          CDS       T00369                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00010  Glycolysis / Gluconeogenesis
ypa01100  Metabolic pathways
ypa01110  Biosynthesis of secondary metabolites
ypa01120  Microbial metabolism in diverse environments
ypa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    YPA_1513
Enzymes [BR:ypa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     YPA_1513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABG13480
JGI: YPA1513
UniProt: A0A0E1NNP5
Position
complement(1697922..1698797)
Genome map
AA seq 291 aa AA seqDB search
MNEKVFTLPVVEQISPYISQRQLDELPVVVVSHPKVRAAISLQGAHLLAYQPSGEQPIIW
LSNNTPFKEGIAIRGGVPICWPWFGPTAQPAHGFARILPWTLSAHDENENGVILTFTLED
NDMTRQYWPHAFTLIARFKLGDECEVELESHGDYQAAAALHTYFQIGDISQIKVSGLGEK
YLDKVLKVADVTQQGDLVFNGQTDRVYTQPEAYSLIKDAALKRTIEVHHHHQSDVVAWNP
GAELSCSMVDMPNDGYKTMVCVETARVNKPLVAAPDAPARLAMTIRSRKNT
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaaagtatttactctccctgttgttgaacaaatttctccttatatcagccag
cgtcaactggatgaattgccggtagtggttgtttctcatcctaaggtgcgtgcggcaata
agtttgcagggggcccacttactggcctatcaacccagtggtgagcaacccattatctgg
ctgagcaataacacgccttttaaagaaggtattgcgattcgtggaggggttccaatttgt
tggccttggtttggcccaaccgcacaacctgcccatggttttgcccgcatcttgccatgg
acgctcagtgctcatgatgaaaatgaaaacggcgtcattctgactttcacccttgaagac
aacgacatgacccgccaatactggccacatgccttcaccctgatcgcccgtttcaagttg
ggagatgaatgtgaagttgaactggaatcacacggtgattatcaggctgctgcggcatta
catacctacttccagattggcgatataagccaaattaaagtcagcgggctgggtgagaaa
tatttagataaagtgctgaaagttgccgatgtcactcaacaaggcgatttagtctttaac
ggccaaactgaccgtgtctatacccaacctgaagcctatagtctgataaaagatgccgcg
ctgaaacgaactattgaggtccatcaccatcaccaaagtgatgtggttgcctggaacccc
ggcgctgaattgtcctgcagcatggtagatatgccaaatgatggctataaaacgatggtt
tgcgtagaaaccgcacgagtcaacaagccattggtggctgcgcctgatgcaccagcacgt
ttggcgatgaccatccgtagtcgtaaaaacacctaa

DBGET integrated database retrieval system