KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1517Help
Entry
YPA_1517          CDS       T00369                                 

Definition
nicotinamidase/pyrazinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:ypa00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1701344..1701991)
Genome map
AA seq 215 aa AA seqDB search
MKAALLLIDLQNDFCPGGALAVSEGDEVISVANRMIEACLAKNIPVIASQDWHPIEHRSF
AVNAKAEPGTVGELEGLVQVWWPVHCVQEQPGAALHPQLKQGAITAIFRKGQNPDIDSYS
TFFDNGRRAKTALDSWLQQHSIDHLYVMGLATDYCVKYSVLDALALGYQTTVISDGCRGV
NLQPQDSQLAFDAMSDAGANLLALEQCLAEVVSAD
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagccttgctcttaatcgatttacaaaacgacttttgtcctggtggagcgttg
gctgttagtgaaggtgatgaggtcattagcgtggctaaccgcatgattgaagcctgtctc
gcaaaaaacataccggtgattgccagccaagattggcacccaattgagcaccgtagcttt
gcggtgaacgccaaggcggagccgggcacagttggggaactagaagggttagtacaagta
tggtggccggtacattgtgttcaggaacaaccaggggcagcattgcacccacagctgaaa
caaggcgctattacagctatttttcgcaaagggcaaaaccctgatatcgacagttacagc
actttcttcgacaatggccggcgagctaaaacagcattagatagctggctacaacagcat
agcattgaccacctgtatgttatggggctggccacagattactgtgtgaaatatagcgta
ctggatgcactcgctttgggttatcaaaccacggttatcagtgatgggtgtcgtggggta
aacttgcaaccacaagacagccaactggctttcgatgcaatgagcgatgcaggcgccaac
ttactggctcttgaacaatgcctggctgaagtcgtttcagccgactga

DBGET integrated database retrieval system