KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1564Help
Entry
YPA_1564          CDS       T00369                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPA_1564
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    YPA_1564
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    YPA_1564
Enzymes [BR:ypa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     YPA_1564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1750192..1751382)
Genome map
AA seq 396 aa AA seqDB search
MTTLNPYFGEFGGMYVPQILVPALKQLEDAFVSAQLDPEFQAAFQDLLKNYAGRPTALTL
CQNLTKGTKTKLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASAL
ACALLGLKCRIYMGAKDIERQSPNVFRMRLMGAEVIPVHSGSSTLKDACNEALRDWSGTY
ETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEKEGRLPDAVLACVGGGSNAIGMF
ADFIDEPDVGLIGVEPAGLGIETGQHGAPLKHGKVGIYFGMKSPMMQTSDGQIEESYSIS
AGLDFPSVGPQHAYLNSIGRADYVSITDDEALDAFKTLSCKEGIIPALESSHALAHALKM
IKADPDKEQILVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgacacttaatccctattttggcgaatttggcggtatgtatgtgccccaaatttta
gtgccagccctgaagcaactggaagacgcattcgtcagtgctcaactggatcctgaattt
caggccgcatttcaagatttgttaaaaaactatgccggtcgccctaccgccctgaccttg
tgtcaaaatctgaccaaagggacaaagaccaagctatatctgaaacgtgaagatctgctg
cacggcggtgcacacaaaaccaaccaggttttaggtcaggctttattagctaaacgcatg
ggtaaaactgaaattattgccgaaaccggtgccggccagcacggggttgcctccgcactg
gcttgtgcattgctgggtttaaaatgccgcatttatatgggggcgaaagatattgaacgt
cagtcgcctaacgttttccgtatgcgcctgatgggagccgaggttattccagtgcatagt
ggttcatcgacgctgaaagatgcctgtaatgaagcgctacgtgactggtcaggtacttat
gaaaccgctcactatatgctgggtaccgccgctggccctcacccttacccgacaattgtg
cgcgaattccaacgcatgatcggtgaagaaaccaaggctcagatactggaaaaagaaggc
cgcctgcccgatgcagtattggcctgtgttggtggcggttctaatgctatcggtatgttt
gctgattttattgatgagcctgatgtgggtctgattggcgtagagcctgccggcttgggg
atcgaaaccgggcaacatggtgcccccctaaaacacggtaaggtcggtatctacttcggt
atgaaatcaccgatgatgcagaccagcgatgggcaaattgaagaatcttactctatttct
gccggtctggacttcccctctgtggggccgcaacatgcttatttgaacagtattgggcgg
gctgattatgtctccattaccgatgatgaggctttagacgcatttaagacattgtcatgt
aaagaagggattattccagcgctagagtcctctcatgctctggcacatgcgttgaaaatg
attaaagcggatccggataaagaacaaatactggtggtgaatctctccggccggggtgac
aaagatattttcaccgttcacgatattctgaaagcacggggagagatttaa

DBGET integrated database retrieval system