KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_1843Help
Entry
YPA_1843          CDS       T00369                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    YPA_1843
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    YPA_1843
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     YPA_1843
Two-component system [BR:ypa02022]
 CheA family
  CheA-CheYBV
   YPA_1843
Bacterial motility proteins [BR:ypa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    YPA_1843
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2065681..2066730)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLCVDDSALMRQLMTEIINSHPDMEMVAAAQDPLVARDLIKKFNPQVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKNSEITMRALELGAIDFVTKPQLGIREGMLAYS
ELIADKIRTAAKARLPQRVLENKPAMLSHTPLLSSEKLIAIGASTGGTEAIRAVLQPLPP
TSPALLITQHMPPGFTRSFAERLNKLCQITVKEAEDGERVLPGHAYIAPGDRHLELARSG
ANYQVRIHDGPAVNRHRPSVDVLFRSVAQYAGRNAVGVILTGMGNDGAAGLLEMHRAGAY
TLAQNEASCVVFGMPREAIAMGGVNDVVELNQISQRMLAQISSGQALRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagagtattgtgtgttgatgattctgcattaatgcgtcagctaatgact
gagattattaacagtcacccggatatggagatggttgctgcggcacaggatccgttggtt
gcccgtgatttgatcaaaaaatttaatccacaagttttgacgcttgacgtggaaatgcct
cgcatggatggcttggattttctcgagaaattgatgcgtctacggcccatgccggtggtg
atggtgtcttccctaacgggtaaaaactccgaaataaccatgcgggcgttggagttgggg
gcgattgattttgtcaccaaacctcagttagggatccgcgaaggaatgctggcttacagc
gaactgattgccgataagatccgcacggcggctaaggctcgtttaccacagcgcgtcctg
gaaaataaaccggcgatgctcagccataccccattgctcagcagtgaaaaattgatcgcc
attggggcatcaactggcggtactgaggcgattcgtgcggtattacagcctttgccacca
accagtccggcattgctgatcactcagcatatgccgccgggatttacccgttcgtttgct
gaacgcttgaataaactgtgccaaatcacggtaaaagaagcagaggatggcgagcgagta
ttaccgggacatgcctatattgcacccggtgatcggcacttggaactggcccggagtggt
gccaactaccaggtgcggatccatgatggacccgcggttaatcgtcaccgtccttcggtt
gacgttcttttccgttcggtggcgcagtatgccgggcgcaatgcggtcggggtgatcctc
acggggatgggcaatgatggagccgctggcttgctggagatgcaccgggcgggtgcctac
accctcgcgcaaaatgaggccagctgcgtggtctttggtatgccacgtgaggcgattgcg
atggggggggttaatgacgtcgtggagttgaaccaaataagtcagcggatgttggcgcag
atcagtagtggtcaagcccttcgcatatag

DBGET integrated database retrieval system