KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2244Help
Entry
YPA_2244          CDS       T00369                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    YPA_2244
  Amino acid metabolism
   00300 Lysine biosynthesis
    YPA_2244
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     YPA_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2517727..2518854
Genome map
AA seq 375 aa AA seqDB search
MICPVIELAQQLIKRPSLSPSDAGCQEIMIQRLAAIGFTIEPMNFGDTLNFWAWRGEGET
LAFAGHTDVVPTGDESHWHSPPFEPTIRDGMLYGRGAADMKGSLAAMIVAAERFVAAHPD
HKGRLAFMITSDEEAKATNGTVKVVEALMARHERLDYCLVGEPSSTDRVGDIVKNGRRGS
ITANLRIHGVQGHVAYPHLADNPVHRAMPALNELVATQWDEGNAFFPATSMQIANLQAGT
GSNNVIPGEFYVQFNFRFSTELTDSLIKQRVAALLDRHQLDYTLEWVLSGQPFLTAKGAL
VDAVVNAVKHYTEITPQLLTTGGTSDGRFIALMGAQVVELGPVNATIHKVNECVSAADLQ
LLSRMYQKIMEQLIA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgatctgtccggtaatcgaattggcccaacagttaattaaacgcccatcgctcagccct
tcagatgcgggttgccaagagatcatgatccagcgcctagccgccatcggctttaccatc
gaacccatgaattttggtgatacgcttaatttttgggcatggcgtggcgaaggcgaaacg
ctggcatttgctggtcacacggatgtggtgcctaccggtgacgagagccactggcacagc
ccaccgtttgaacccaccatccgtgacggcatgttgtatggccgaggtgccgcagacatg
aaaggctcactggcagcaatgatcgtagcagccgagcgttttgtcgccgcgcaccctgac
cacaaaggccgcctggcctttatgataacctccgatgaagaagccaaagccaccaacggt
acagtaaaagtggttgaagccctgatggcacgccacgagcggctggattattgtctggtg
ggcgaaccatccagtactgaccgggttggcgatatcgtgaaaaatggccgccgtggctcc
atcaccgctaacttgcgtattcatggagtgcaagggcacgtggcgtatcctcatctggcg
gataatcccgttcatcgtgctatgccagcgctgaatgaattggttgccacccaatgggat
gaaggcaatgcgtttttccctgccaccagtatgcaaattgccaatttacaggccggtacg
ggcagcaataatgttattcccggtgaattttatgtgcagtttaacttccgtttcagtact
gaactgactgacagcctgatcaagcaacgggtagccgcattgctggatcgacatcagctt
gattacaccctggaatgggtattgtctggtcaacctttcctgaccgccaaaggggcgttg
gtggatgccgtggttaatgccgttaagcattacactgaaatcacaccgcaactgttaacc
accggggggacgtcagatggccgctttattgcgttaatgggggcgcaagtggttgagttg
gggccagttaatgccaccattcataaagttaatgaatgtgttagcgcggctgatttacaa
ttgctcagccgtatgtaccagaaaatcatggaacaactgatcgcatga

DBGET integrated database retrieval system