KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2464Help
Entry
YPA_2464          CDS       T00369                                 

Definition
(GenBank) beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00511  Other glycan degradation
ypa00520  Amino sugar and nucleotide sugar metabolism
ypa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPA_2464
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    YPA_2464
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     YPA_2464
Chaperones and folding catalysts [BR:ypa03110]
 Intramolecular chaperones
  Others
   YPA_2464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX_C Glyco_hydro_20b BNR
Motif
Other DBs
NCBI-ProteinID: ABG14429
JGI: YPA2464
UniProt: A0A0H2Y8X4
Position
complement(2745653..2747755)
Genome map
AA seq 700 aa AA seqDB search
MMTPESRFVKNEAVKTLSAANLRGQIIPTPLDVKVYPQDADLSLGVALELSALPKPASDA
IQQRFELLGLALSATGYPIKTVIQPTAFNGDHAVSGAYELKIGEKGAEVIGFDQVGVFYG
LQSILSLVPIEGSKTIATLDAKDAPRFDYRGVSLDVGRNFKTKAAVLRLLDQMSAYKLNK
FHFHLSDDEGWRIEIPGLPELTDVGSQRCHDLTETTCLLPQLGSGPESNNLGSGYFTRAD
YIDILKYAKARQIDVIPEIDIPAHARAAVVSMEARYNNLMKQGKEKEANEFRLVDPTDDS
NTTSVQFYERKSYLNPCLDSSKHFVDKVIGEMAKMHKEAGMPLTTWHFGGDEAKNIRLGA
GYQDKNGKIEPGKGIIDMRVEDKPWAKSQVCQDMVKQGKVQDIAHLSSYFAIEVSKLVNA
HGIEKMQAWQDGLRDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANKGYEVIASNPDY
VYFDMPYEVNPSERGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGNHFSAKSDKPWP
GVQGISGQSWNETVRTDEQMEYMAFPRVLPLAERAWHRASWEQEYKAGREYKGGETQWVD
TQALSTDWQRFANIMGQRELAKLDKAGVAYRLPVPGARVVAGQLEANISLPGLLIEYSTD
GGKKWQQYDAKAQPTVSGEVMIRSTSPDGKRSSRAEPVNI
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgccagaatcacgtttcgtcaaaaacgaggcagtgaaaacactctctgcggct
aacctgcgtgggcagattatcccaacaccactggacgttaaggtttatccgcaagatgcc
gatctgagcctcggtgtggcgctggaattgagtgcgctacccaaaccggcctctgatgcc
atacagcaacgttttgaattgctgggcctggcgctaagcgcgacgggctatccgattaaa
acagtgattcagccaacggccttcaacggggatcacgctgtttccggtgcgtatgaactg
aaaattggtgagaagggcgcagaggtgattggttttgatcaggtcggtgtattctatggc
ctgcaatctatcctttccttggtacctattgaggggagcaaaacaatagccacccttgat
gcgaaagatgcgccacgctttgactaccgtggtgtctcgctcgatgtggggcgtaacttc
aaaaccaaagcggcggtcctacgtttattggatcaaatgtctgcttacaaactgaataaa
ttccacttccatctgagtgatgatgaaggctggcgcattgagatccctggcctgcctgaa
ttgaccgatgtcggcagccagcgttgccatgatttgactgaaaccacctgtttgctacca
cagctaggctctggccctgagagcaataatctggggagcggttatttcactcgcgctgat
tacatcgatattctgaaatatgccaaagcgcgccagattgatgtcattcctgagatagat
atcccggctcacgcccgtgctgctgtggtatcgatggaagcgcgttataacaatttgatg
aaacagggtaaagagaaagaagccaatgaattccgtctggttgatccgaccgatgactcg
aataccacatcagtacagttctatgagcgtaaaagttacctgaatccctgcctggactct
tctaagcattttgtcgacaaagtcattggtgaaatggcgaagatgcacaaagaggccggt
atgccgctgaccacctggcatttcgggggcgatgaggcgaagaacatccgtctgggggcg
ggttatcaggataagaatggcaaaattgagccaggtaaaggcatcatcgatatgcgcgtt
gaagataaaccgtgggcgaaatctcaggtttgtcaggacatggtcaagcaaggcaaagtt
caagatattgctcatctttccagctacttcgccattgaagtcagcaaactggttaatgcg
cacggtatcgaaaaaatgcaggcctggcaggatggactgagagatgccaaagatgcgagc
gcgtttgctaccaagcgtgttggcgtcaacttctgggataccctctactggggcggagcg
gactccgtcaacgattgggccaataaaggttatgaagtcattgcctcgaatccagattat
gtctacttcgatatgccgtatgaagttaacccaagtgaacgcggttactactgggcgacg
cgctttagcgatgaagccaaggtgttcagcttcgcacctgacaacatgccacagaacgcc
gaaacctcggttgatcgcgatggtaatcatttcagtgcgaagagtgataaaccctggccg
ggtgtacagggtatctccggtcagtcttggaatgaaacggtacggactgatgagcagatg
gagtacatggccttccctcgtgtattaccgctggctgagcgtgcatggcatcgcgcatcc
tgggagcaggagtataaagcggggcgtgaatataaaggtggcgagactcagtgggtcgat
actcaggcattaagcacggattggcagcgtttcgctaacattatggggcaacgtgaactg
gcaaaactggataaagcgggtgtggcttaccgcttgccagtaccgggggccagagtggtg
gcggggcagttggaagccaatatttccttgccaggcctccttatcgagtactccactgat
ggaggcaaaaaatggcagcagtatgatgctaaagcgcaacctactgtcagcggtgaagtg
atgatccgttccaccagcccagacggtaagcgcagtagccgtgcggagccagttaacatc
tga

DBGET integrated database retrieval system