KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2464Help
Entry
YPA_2464          CDS       T00369                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ypa00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ypa00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2745653..2747755)
Genome map
AA seq 700 aa AA seqDB search
MMTPESRFVKNEAVKTLSAANLRGQIIPTPLDVKVYPQDADLSLGVALELSALPKPASDA
IQQRFELLGLALSATGYPIKTVIQPTAFNGDHAVSGAYELKIGEKGAEVIGFDQVGVFYG
LQSILSLVPIEGSKTIATLDAKDAPRFDYRGVSLDVGRNFKTKAAVLRLLDQMSAYKLNK
FHFHLSDDEGWRIEIPGLPELTDVGSQRCHDLTETTCLLPQLGSGPESNNLGSGYFTRAD
YIDILKYAKARQIDVIPEIDIPAHARAAVVSMEARYNNLMKQGKEKEANEFRLVDPTDDS
NTTSVQFYERKSYLNPCLDSSKHFVDKVIGEMAKMHKEAGMPLTTWHFGGDEAKNIRLGA
GYQDKNGKIEPGKGIIDMRVEDKPWAKSQVCQDMVKQGKVQDIAHLSSYFAIEVSKLVNA
HGIEKMQAWQDGLRDAKDASAFATKRVGVNFWDTLYWGGADSVNDWANKGYEVIASNPDY
VYFDMPYEVNPSERGYYWATRFSDEAKVFSFAPDNMPQNAETSVDRDGNHFSAKSDKPWP
GVQGISGQSWNETVRTDEQMEYMAFPRVLPLAERAWHRASWEQEYKAGREYKGGETQWVD
TQALSTDWQRFANIMGQRELAKLDKAGVAYRLPVPGARVVAGQLEANISLPGLLIEYSTD
GGKKWQQYDAKAQPTVSGEVMIRSTSPDGKRSSRAEPVNI
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgccagaatcacgtttcgtcaaaaacgaggcagtgaaaacactctctgcggct
aacctgcgtgggcagattatcccaacaccactggacgttaaggtttatccgcaagatgcc
gatctgagcctcggtgtggcgctggaattgagtgcgctacccaaaccggcctctgatgcc
atacagcaacgttttgaattgctgggcctggcgctaagcgcgacgggctatccgattaaa
acagtgattcagccaacggccttcaacggggatcacgctgtttccggtgcgtatgaactg
aaaattggtgagaagggcgcagaggtgattggttttgatcaggtcggtgtattctatggc
ctgcaatctatcctttccttggtacctattgaggggagcaaaacaatagccacccttgat
gcgaaagatgcgccacgctttgactaccgtggtgtctcgctcgatgtggggcgtaacttc
aaaaccaaagcggcggtcctacgtttattggatcaaatgtctgcttacaaactgaataaa
ttccacttccatctgagtgatgatgaaggctggcgcattgagatccctggcctgcctgaa
ttgaccgatgtcggcagccagcgttgccatgatttgactgaaaccacctgtttgctacca
cagctaggctctggccctgagagcaataatctggggagcggttatttcactcgcgctgat
tacatcgatattctgaaatatgccaaagcgcgccagattgatgtcattcctgagatagat
atcccggctcacgcccgtgctgctgtggtatcgatggaagcgcgttataacaatttgatg
aaacagggtaaagagaaagaagccaatgaattccgtctggttgatccgaccgatgactcg
aataccacatcagtacagttctatgagcgtaaaagttacctgaatccctgcctggactct
tctaagcattttgtcgacaaagtcattggtgaaatggcgaagatgcacaaagaggccggt
atgccgctgaccacctggcatttcgggggcgatgaggcgaagaacatccgtctgggggcg
ggttatcaggataagaatggcaaaattgagccaggtaaaggcatcatcgatatgcgcgtt
gaagataaaccgtgggcgaaatctcaggtttgtcaggacatggtcaagcaaggcaaagtt
caagatattgctcatctttccagctacttcgccattgaagtcagcaaactggttaatgcg
cacggtatcgaaaaaatgcaggcctggcaggatggactgagagatgccaaagatgcgagc
gcgtttgctaccaagcgtgttggcgtcaacttctgggataccctctactggggcggagcg
gactccgtcaacgattgggccaataaaggttatgaagtcattgcctcgaatccagattat
gtctacttcgatatgccgtatgaagttaacccaagtgaacgcggttactactgggcgacg
cgctttagcgatgaagccaaggtgttcagcttcgcacctgacaacatgccacagaacgcc
gaaacctcggttgatcgcgatggtaatcatttcagtgcgaagagtgataaaccctggccg
ggtgtacagggtatctccggtcagtcttggaatgaaacggtacggactgatgagcagatg
gagtacatggccttccctcgtgtattaccgctggctgagcgtgcatggcatcgcgcatcc
tgggagcaggagtataaagcggggcgtgaatataaaggtggcgagactcagtgggtcgat
actcaggcattaagcacggattggcagcgtttcgctaacattatggggcaacgtgaactg
gcaaaactggataaagcgggtgtggcttaccgcttgccagtaccgggggccagagtggtg
gcggggcagttggaagccaatatttccttgccaggcctccttatcgagtactccactgat
ggaggcaaaaaatggcagcagtatgatgctaaagcgcaacctactgtcagcggtgaagtg
atgatccgttccaccagcccagacggtaagcgcagtagccgtgcggagccagttaacatc
tga

DBGET integrated database retrieval system