KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2575Help
Entry
YPA_2575          CDS       T00369                                 

Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1 (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ypa01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2868112..2868750
Genome map
AA seq 212 aa AA seqDB search
MMNFKNVFRWHLPFLLLLGLFSLRAAATDTLLILGDSLSAGYRLPIAQAWPSLLDKKWQA
TPSLPKVVNASISGDTAAQGLARLPALLKQHQPRWVLIELGANDALRGFPTQDIQRDLSE
IINQITAAKAQPLLMQIRIPPNYGRRYTDAFTAIYPQLAQQFDIPLLPFFMEQVAVKPEW
MQDDGLHPNGDAQPFIADWMAQQLKPLVVDPK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaacgttttccgctggcatcttcccttccttttactgttgggatta
ttcagtttgcgtgccgccgcaaccgatacactattgattctcggcgacagtttaagcgcc
ggttaccgcctgcctattgcacaggcatggccttcgctattggataaaaaatggcaagcc
acgccttcattaccgaaggtggtcaatgccagtatcagtggagataccgccgcgcaaggg
ctagcgcgcttacccgctctactcaaacaacatcagccacgctgggtgctgattgaactg
ggcgccaatgacgcgctgcgcgggtttccgacgcaggacattcaacgggatctgagcgaa
attatcaatcagataaccgcagcgaaagcccagccattattgatgcaaatccgtattccc
cctaactatggccgccgttatactgatgctttcaccgctatctatccacaactggcgcaa
cagttcgacatccccctactccctttttttatggaacaggttgccgttaagccagagtgg
atgcaggatgatggtttacaccctaacggcgatgcccaaccgtttatcgcggattggatg
gcgcaacaactcaagccgttagttgttgatccgaaataa

DBGET integrated database retrieval system