KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2614Help
Entry
YPA_2614          CDS       T00369                                 

Definition
(GenBank) DNA replication and repair protein RecR
  KO
K06187  recombination protein RecR
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    YPA_2614
DNA repair and recombination proteins [BR:ypa03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     YPA_2614
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      YPA_2614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH_5 HHH
Motif
Other DBs
NCBI-ProteinID: ABG14576
JGI: YPA2614
UniProt: Q1C4P6
Position
complement(2909632..2910237)
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFQLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQEHCTICLNPRRQQNGQICVVESPADIHAIEQTGQFGGRYFVLMGHLSPMDGIGP
GDIGLDLLEKRLSTEAISEVILATNPTVEGDATANYIGQMCGQYGILASRIAHGVPVGGE
LEMVDGTTLSHSLAGRNPIKY
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccactcctggagtcattaatggaggcgttgcgttgtttaccgggtgtt
ggcccgaaatcggcgcaacgtatggcatttcagctattacagcgcgatcgtagtggtgga
atgcgcctggcgcaggctctgacacgggcaatgtctgaaataggccattgtgcagattgt
cgtacatttaccgagcaagagcactgcaccatctgcttgaatccccgccgtcaacaaaat
ggtcaaatctgtgtggtcgaaagcccggcagatatccatgccattgagcaaactggccag
tttggcgggcgttattttgtgctgatggggcatttatcacctatggatggtattggccct
ggtgatatagggctagatctactggagaaacggctttctactgaggctatcagtgaggtc
attttagccacgaatccaaccgttgaaggggatgcaacagccaactatatcggccagatg
tgtggccaatatggcatactggccagccgcatcgcccatggcgttcctgttggtggcgag
ttagaaatggttgatggcaccacgttatctcactcgttagcagggcgtaatcccatcaag
tactga

DBGET integrated database retrieval system