KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2786Help
Entry
YPA_2786          CDS       T00369                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
Enzymes [BR:ypa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     YPA_2786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_31 Methyltransf_25 Methyltransf_23 Methyltransf_11 CMAS GCD14 DREV
Motif
Other DBs
NCBI-ProteinID: ABG14748
JGI: YPA2786
UniProt: Q1C474
Position
3104911..3105537
Genome map
AA seq 208 aa AA seqDB search
MVNKRMQTLLMQLRQQGIHDERLLQAIEAVPRERFVDEALAHKAYENTALPIGAGQTISQ
PYMVARMTELLQLTPTSRVLEIGTGSGYQTAILAHLVDHVCSVERIKGLQWQAKRRLKQL
DLHNVSTRHGDGWLGWQSRGPFDAIIVTAAPPEIPDALLEQLDEGGILVLPVGEQFQTLK
YVQRRNNEYHIETVEAVRFVPLVKGELA
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggtaaataaacgcatgcaaacattgttgatgcagttacgtcagcaaggtattcacgat
gaacgcctgttacaggcgatcgaagcggtaccgcgtgagcgttttgtcgatgaagcgttg
gctcataaggcttatgagaataccgctctccctataggtgcggggcaaacgatttctcag
ccttatatggtggcgcgaatgacagagttactgcaattgacgccaacgtccagagtctta
gagatcggaacggggtcaggctaccagacggctattttggcgcatctggtcgatcatgtc
tgttcagtcgagcgaatcaaagggttacagtggcaggcaaaacgtcgcctaaaacagttg
gatctgcataatgtgtcgacccgccatggtgatggttggttgggctggcagtctcgtggg
ccgtttgatgccattattgtaaccgcagcaccgcctgaaattccggatgcattacttgag
caattggatgaagggggaatactggttcttcccgttggtgagcagttccaaacattaaag
tacgtgcaacgccgtaacaatgaataccatattgagacggtggaagccgtccgttttgtt
cctctggttaaaggggaacttgcctaa

DBGET integrated database retrieval system