KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_2901Help
Entry
YPA_2901          CDS       T00369                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ypa00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Structure
PDB: 

Jmol
Position
3230901..3231380
Genome map
AA seq 159 aa AA seqDB search
MIRVYIALGSNLAMPLQQVSAAREALAHLPRSRLVACSPLYRTKPLGPQDQPDFLNAVVA
LDTSLPPEQLLDHTQAIERNQGRVRKEQRWGPRTLDLDIMLYGDQVIKTDRLTIPHYGLK
AREFMLYPLADIAPDLIFPDGESLSECLKRVDKNGLVLW
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgatccgggtctatatcgcgctgggtagcaatttggccatgccactacaacaggttagc
gcggcacgggaagccttggcgcatctgccgcgtagccggttagtagcgtgttcgccactt
taccgcaccaagccattaggcccacaggatcaacccgattttctcaatgccgtggtcgca
ctggatacatcgttgccaccagagcagttgctggatcacacacaagcgattgaacgtaac
caaggccgggtgagaaaagagcagcgctgggggccacggacgctggatctggatattatg
ttgtatggcgatcaggtgataaaaactgatcgcctgacgattccgcattatggtctgaaa
gcgcgtgaatttatgctctatccactggcagatatcgccccagatcttattttccccgat
ggcgaatccctatcagaatgccttaagcgggtcgataagaacggcttggttctctggtaa

DBGET integrated database retrieval system