KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3436Help
Entry
YPA_3436          CDS       T00369                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase / short chain enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
ypa00071  Fatty acid degradation
ypa00280  Valine, leucine and isoleucine degradation
ypa00281  Geraniol degradation
ypa00310  Lysine degradation
ypa00362  Benzoate degradation
ypa00380  Tryptophan metabolism
ypa00410  beta-Alanine metabolism
ypa00640  Propanoate metabolism
ypa00650  Butanoate metabolism
ypa00903  Limonene and pinene degradation
ypa00930  Caprolactam degradation
ypa01040  Biosynthesis of unsaturated fatty acids
ypa01100  Metabolic pathways
ypa01110  Biosynthesis of secondary metabolites
ypa01120  Microbial metabolism in diverse environments
ypa01130  Biosynthesis of antibiotics
ypa01200  Carbon metabolism
ypa01212  Fatty acid metabolism
Module
ypa_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    YPA_3436
   00650 Butanoate metabolism
    YPA_3436
  Lipid metabolism
   00071 Fatty acid degradation
    YPA_3436
   01040 Biosynthesis of unsaturated fatty acids
    YPA_3436
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    YPA_3436
   00310 Lysine degradation
    YPA_3436
   00380 Tryptophan metabolism
    YPA_3436
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    YPA_3436
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    YPA_3436
   00281 Geraniol degradation
    YPA_3436
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    YPA_3436
   00930 Caprolactam degradation
    YPA_3436
Enzymes [BR:ypa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     YPA_3436
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     YPA_3436
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     YPA_3436
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     YPA_3436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: ABG15398
JGI: YPA3436
UniProt: Q1C2C4
Position
3839710..3841899
Genome map
AA seq 729 aa AA seqDB search
MLYQSETLQLHWLENGIAELVFDAPGSVNKLDTKTVANLGEALNVLEKQSELKGLLLRSA
KTALIVGADITEFLSLFNAPPEKLHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCEC
ILATDFRIASPEARIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIATGKDVTANDALK
IGLVDAVVDPEKLVGSALTMLKQAIDGKLDWQAARRPKLEPLKLNPTEAAMCFTIAKGRV
MQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQYVK
AQAKKLSKGVAAPKLAAVLGAGIMGGGIAYQSALKSVPVIMKDINENSLDLGMNEAAKLL
NKQLERGKVDGLKMASILATIRPTLDYAGIERAQVIVEAVVENPKVKAAVLAEVEALIGE
DTVLASNTSTIPIDQLAKSLKRPENFCGMHFFNPVHRMPLVEIIRGAKTSDKTLAAVVAY
ATQMGKTPIVVNDCPGFFVNRVLFPYLAGFGMLVRDGGDFHQIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPERMNKDYRDAVDVMFDNQRFGQKNGQGFYRYTQDAKGKP
RKENDEQVDKLLAEISQPLQEFSDEDIIARTMIPMINEVVRCLEEGIIASAAEGDMALVY
GLGFPPFHGGVFRYLDTLGSANYVEMAQRYAHLGALYHVPAGLRAKAEHNESYYPVAAAL
LDVSTNQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctctaccaaagcgaaacattacagcttcactggttggaaaacggtattgccgagttg
gtatttgatgctccgggttcagttaataaactggatactaaaaccgtagccaatttgggt
gaagccttgaatgtgttagaaaaacaaagtgaactcaaagggttgctattacgttcagcg
aagacagccttgattgttggtgccgatattactgagtttctatccctgtttaatgcccca
ccagaaaaactgcaccagtggctggtgttcgccaacaccattttcaatcgactggaagat
ttacccgtgccaaccatttcagcaattaatggatacgcactaggtggaggatgtgaatgt
attttggcgacggatttccgtatcgcctccccagaagcacgtatcggcctcccagaaacc
aagttgggcatcatgccgggcttcggtggttcggtccgtttaccacgcctgctaggcgct
gatagtgcacttgagattattgccacaggtaaagatgttactgccaacgatgcactaaag
attgggctggttgatgcagttgtcgaccctgagaaactggtcggttcagccttaactatg
ctgaaacaagctattgacggtaagctcgattggcaggcagcacgccgcccaaaactggaa
cccctaaaacttaatcctaccgaagcggctatgtgttttaccattgctaaaggcagagtc
atgcaagtcgccgggaaacactatcccgcaccattgactgcagtaaaaactattgaagcc
gccgcaaaatttggtcgtaccgaagcgctgaacttggaaaccaacagttttgtcccttta
gcgggttccaatgaagctcgcgctttggtggggatttttcttaacgaccagtatgtaaaa
gcgcaagccaaaaaactgtccaaaggcgtcgctgcaccaaaactggctgcggttctgggc
gcagggatcatgggaggtggaattgcctatcagtcagcgctgaaaagtgtgccagtcatt
atgaaagatattaatgaaaactcgctggatcttggaatgaatgaggccgctaaattactg
aataaacagctggaacgcggcaaagtggatggccttaaaatggcaagtattctagcgact
attcgaccaaccttggattatgcaggtattgaacgagcccaagtgatcgtcgaagctgtg
gtggagaacccgaaggttaaagccgctgtacttgcggaagtagaagcattaatcggtgaa
gataccgttttagcttccaatacctcgacgattcctattgatcagttggctaaatcactc
aaacgccctgaaaatttctgcggtatgcacttcttcaatccagtacaccggatgccactg
gttgaaattattcgtggggcaaaaacctcagataaaacccttgcggcagtagtcgcttac
gctacacaaatggggaaaaccccaattgttgtcaatgattgccctggtttcttcgttaac
cgcgtcttattcccgtatctcgcaggctttggcatgttagtcagagacggtggggatttc
caccaaattgataaagtgatggaaaaacagtttggctggccgatggggcccgcttatcta
ttagatgtcgtcggtattgatactgcccatcatgcacaagcggtgatggctgccggtttc
cctgagcgaatgaacaaggattaccgtgatgcggttgatgtgatgtttgataaccaacga
tttgggcaaaagaatggtcaggggttttaccgctatacgcaagatgcaaagggtaagcca
cgtaaagaaaatgacgaacaagtggataaattactggcagaaatcagccaacctctccaa
gaattcagcgatgaagacattattgcccgcaccatgatcccaatgatcaatgaagtcgtc
cgctgcctggaagaaggtattattgccagcgcagccgagggtgacatggcgctggtttat
ggccttggcttccctccattccacggaggagtcttccgttaccttgatacgctcggtagc
gcaaattatgtcgaaatggctcaacgctatgcccaccttggtgcgttatatcacgttcct
gcggggctacgagctaaagctgaacataacgaaagttattatcctgtggcagcagcgctg
cttgatgtttctaccaatcaaccagcatga

DBGET integrated database retrieval system