KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3451Help
Entry
YPA_3451          CDS       T00369                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    YPA_3451
Enzymes [BR:ypa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     YPA_3451
Exosome [BR:ypa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   YPA_3451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3856866..3858389
Genome map
AA seq 507 aa AA seqDB search
MTTENTTQKKYIVALDQGTTSSRAVVLDHNANIVSVSQREFTQIYPKAGWVEHDPMEIWA
TQSSTLIEVLAKAGINSDEIAGIGITNQRETTIVWDKVTGKPVYNAIVWQCRRTADICEK
LKKEGLEEYIRHNTGLVVDPYFSGTKVKWILDNVEGARERAERGELLFGTVDTWLVWNMT
QGRVHVTDYTNASRTMMFNIRTKEWDDRMLKALNIPRAMLPEVRPSSEIYGKTNIGGKGG
TRIPIAGIAGDQQAALFGQLCVQPGMAKNTYGTGCFLLMNTGEEAVQSTHGLLTTIACGP
RGEVNYALEGAVFIGGASIQWLRDELKLIGDATDSEYFATKVKNSNGVYVVPAFTGLGAP
YWDPYARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLDAMQADSGARLKSLRVDGGAVA
NNFLMQFQADILGTRVERPAIRESTALGAAFLAGLATGFWDDLDEVKSKASIEREFRPGI
ETTERDIRYKGWKKAVARARDWEEHDE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatactactcaaaaaaaatacattgtcgcacttgatcaggggacaacc
agctccagggcggtagtactggatcacaatgcaaatatcgtgagtgtttctcagcgtgaa
ttcactcagatttacccaaaggctggctgggttgagcatgacccaatggagatctgggcg
acccaaagctctacactgattgaagtcctggccaaagccggtatcaactctgatgaaatc
gcgggtatcggtattaccaatcagcgcgaaaccacgattgtttgggataaagtgaccggt
aagccggtgtataacgccattgtctggcaatgccgccgtactgcggatatttgcgaaaaa
ctgaaaaaagaagggctggaagagtatatccgccacaacaccggtttggtggtagatccc
tacttctctggcacaaaagtgaaatggatcctcgataacgtcgagggcgctcgcgagcgc
gctgaacgcggtgagttactgtttggtaccgtagacacctggctggtgtggaatatgacg
caaggccgtgtgcacgtcaccgactataccaacgcatcacggaccatgatgtttaacatc
cgtaccaaggagtgggacgaccgtatgctgaaagcgctgaatattccacgcgccatgcta
ccggaagttcgcccatcctccgaaatctacggcaaaaccaatatcggtggcaaaggtggc
actcgtattccaatcgccgggattgccggtgaccagcaagccgctctgtttggtcagctt
tgtgtacagccgggcatggcaaaaaatacctacggtacgggttgcttcctgctgatgaac
accggtgaagaagcggttcaatctactcatggcctgttgaccaccattgcctgtggccca
cgcggtgaagtgaattatgcactggaaggggctgtatttattggtggtgcctccattcaa
tggctacgtgatgaattgaagttgataggcgatgccaccgattctgagtatttcgcgacc
aaagtgaaaaacagtaatggtgtgtatgtggtaccggccttcaccggtctgggcgctcct
tactgggacccgtatgcccgtggtgcgattttcggcctgacccgtggtgttaacagcaac
cacattatccgtgcaacgctcgaatccatagcttatcagacccgcgatgtcttggatgcc
atgcaagctgactccggcgcacggctgaaatcactgcgtgttgatggcggtgcagtagct
aataacttcctgatgcagttccaggccgatattctgggtacccgtgttgagcgccctgct
attcgtgaaagtacagcattgggtgctgcattcctggcaggtctggcgacgggcttctgg
gatgacctcgatgaggtgaagagtaaagcaagcattgaacgcgaattccgtccagggatt
gaaaccacagagcgtgatatccgttacaagggctggaaaaaagcagtggcccgcgcccgg
gattgggaagagcacgacgagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system