KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3734Help
Entry
YPA_3734          CDS       T00369                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    YPA_3734
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    YPA_3734
Enzymes [BR:ypa01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     YPA_3734
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4185043..4186305
Genome map
AA seq 420 aa AA seqDB search
MDKFRVQGRTRLSGEVTISGAKNAALPILFAALLAEEPVELQNVPKLKDIDTTIKLLSQL
GTKIERNNGSVFVDASAVNEFCAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGA
RPVDLHITGLEQLGAEIKLEEGYVKASVNGRLKGAHIVMDKVSVGATVTIMSAATLAEGT
TVIENAAREPEIVDTANFLNTLGAKISGAGTDRITIEGVTRLGGGVYRVLPDRIETGTFL
VAAAISGGKVVCRQTRPDTLDAVLAKLREAGADIEVGDDWISLDMQGKRPKAITFRTAPH
PGFPTDMQAQFSLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICYGVEQ
LSGAQVMATDLRASASLVLAGCIAEGVTIVDRIYHIDRGYERIEDKLRALGAKIERVKGE
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggataagtttcgtgtgcaggggcggactcgcctgagcggtgaagtcactatttccgga
gcgaaaaatgctgcgttaccgatattgtttgcagcattgttagcagaagagccggtagag
ctacaaaatgtcccaaagctaaaagacattgataccaccattaagttgctcagccagtta
ggcactaaaattgaacgtaataatggttccgtttttgttgatgccagcgctgttaatgag
ttttgtgcgccttacgatttagtgaaaacgatgcgtgcctctatttgggcgttggggcca
ctggttgcccgttttggccaaggtcaggtttctttgcctggtggttgtgcgattggcgca
cgtccggttgatttgcacatcacgggtctagaacaactgggtgctgaaatcaagctggaa
gaaggctacgttaaggcctccgttaatggccgcctaaaaggtgctcatatcgtgatggat
aaagtcagcgtgggtgcgacggtgactatcatgagtgcggcaacactggcggaagggacg
accgtgattgaaaatgcggcccgtgaaccagagattgttgatacggcgaacttcctgaat
acgctgggtgctaaaatcagtggtgccggtactgaccgcattaccattgagggggttacc
cgtttaggggggggcgtataccgtgtgctacctgaccgcatcgaaaccggtactttcctg
gttgccgcagccatttcaggtggcaaagtggtgtgccgccaaacacgccctgacacgctg
gatgctgtcttggctaaactgcgcgaagcaggtgctgatattgaagtcggtgatgattgg
atcagtctggatatgcagggtaaacgccctaaagccattacctttcgtaccgcgccacac
cctggcttcccaacggatatgcaggcccaattcagtttattgaatctggtggctgaagga
acgggtgtcatcactgaaaccattttcgaaaatcgttttatgcacgtcccagagcttatt
cgaatgggcgcacatgcagaaatcgagagcaataccgtgatttgctatggcgttgaacaa
ctttctggtgctcaggttatggcaaccgatttacgtgcttccgccagcctggtattagcc
ggttgtatcgctgaaggcgtaacaatcgttgaccgtatttatcacatcgatcgtggctac
gaacgtattgaagataaactgcgggcgctaggtgcgaagattgaacgcgtgaaaggcgag
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system