KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3825Help
Entry
YPA_3825          CDS       T00369                                 

Definition
endo-1,4-D-glucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    YPA_3825
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YPA_3825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
complement(4306809..4307729)
Genome map
AA seq 306 aa AA seqDB search
MVADDQPMFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYN
LLEAGRLWGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLP
PQLLARFSSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDA
ILVYLWAGMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAAL
LPFLASSPEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQP
SWHRQR
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
ttggttgcggatgatcagccgatgtttgagcgtttattggcttggacagaaaacaatctg
gcagccggtgatctcacttcccgccttcccgcttggttatgggggcaaaactcacaaaat
aactgggatattctggaccctaattcggcctccgatgcggatatcttgattgcctacaac
ttgctggaggctggcaggttatggggtaaccgccgttacctgattatgggtaccttatta
ctgcaacgtattgcgcaagaagaagtcatggatattcccggccttggccagatgctatta
ccgggaaaaattggttttaacgatgaggatacctggcgtctcaacccaagttatttaccg
ccacaactactggcacgattttcctccatagacgggccttgggaagcgatggtagaagtg
aatcagcgtatgtggctggaaaccgcaccaaacggtttttcgctggactgggtggtctgg
cagaaaggtaaaggctggcagcccgataccataaaaccggatgtcggcagtaacgatgcc
attctggtttatctgtgggcggggatgctggcaatggacagcccacaaaaagctgaattg
attgcgcgttttcagccaatggcggtaatcactcagcagcaaggcctgccaccgtttacg
accaacagcgacaatggtaaaactaacggggatggggcagtgggtttttctgcggcatta
ttgccctttttagccagcagcccagaaccgtttaatcagcaaacactgaatctccaacag
cgacgggtacaaaattcaccgcctggcgctgatgattattacagtgctattctgaccctg
tttggtcaggggtggttacagcatcgttatcattttacccatcagggagagctacagccc
tcatggcaccgtcaacgttaa

DBGET integrated database retrieval system