KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3825Help
Entry
YPA_3825          CDS       T00369                                 

Definition
(GenBank) Cellulase
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Brite
Enzymes [BR:ypa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     YPA_3825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(4306809..4307708)
Genome map
AA seq 299 aa AA seqDB search
MFERLLAWTENNLAAGDLTSRLPAWLWGQNSQNNWDILDPNSASDADILIAYNLLEAGRL
WGNRRYLIMGTLLLQRIAQEEVMDIPGLGQMLLPGKIGFNDEDTWRLNPSYLPPQLLARF
SSIDGPWEAMVEVNQRMWLETAPNGFSLDWVVWQKGKGWQPDTIKPDVGSNDAILVYLWA
GMLAMDSPQKAELIARFQPMAVITQQQGLPPFTTNSDNGKTNGDGAVGFSAALLPFLASS
PEPFNQQTLNLQQRRVQNSPPGADDYYSAILTLFGQGWLQHRYHFTHQGELQPSWHRQR
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgtttgagcgtttattggcttggacagaaaacaatctggcagccggtgatctcacttcc
cgccttcccgcttggttatgggggcaaaactcacaaaataactgggatattctggaccct
aattcggcctccgatgcggatatcttgattgcctacaacttgctggaggctggcaggtta
tggggtaaccgccgttacctgattatgggtaccttattactgcaacgtattgcgcaagaa
gaagtcatggatattcccggccttggccagatgctattaccgggaaaaattggttttaac
gatgaggatacctggcgtctcaacccaagttatttaccgccacaactactggcacgattt
tcctccatagacgggccttgggaagcgatggtagaagtgaatcagcgtatgtggctggaa
accgcaccaaacggtttttcgctggactgggtggtctggcagaaaggtaaaggctggcag
cccgataccataaaaccggatgtcggcagtaacgatgccattctggtttatctgtgggcg
gggatgctggcaatggacagcccacaaaaagctgaattgattgcgcgttttcagccaatg
gcggtaatcactcagcagcaaggcctgccaccgtttacgaccaacagcgacaatggtaaa
actaacggggatggggcagtgggtttttctgcggcattattgccctttttagccagcagc
ccagaaccgtttaatcagcaaacactgaatctccaacagcgacgggtacaaaattcaccg
cctggcgctgatgattattacagtgctattctgaccctgtttggtcaggggtggttacag
catcgttatcattttacccatcagggagagctacagccctcatggcaccgtcaacgttaa

DBGET integrated database retrieval system