KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3846Help
Entry
YPA_3846          CDS       T00369                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPA_3846
Enzymes [BR:ypa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPA_3846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4332556..4333428)
Genome map
AA seq 290 aa AA seqDB search
MAIIGQTSSLAPADKRFYATRDITATVDSIPLITASILAKKLAEGLDALVMDVKVGSGAF
MPTYSLSADLAQAIVGVANGAGCKTTALLTDMNQVLASSAGNGVEVREAVRFLTGEYRNP
RLLEVTMALCVEMLLSGGLAHDEADARAKLQAVLDNGKAAEVFGRMVAAQKGPADFVERY
DSYLPVATLSKPVFAEQTGIITAMDTRALGMAVVALGGGRRRATDPIDYSVGLTEMARLG
TRVDGQQPLAVIHANNEDDWQQAAEVVRAAITLGNNTPEETPVIYRRITE
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttacgcgacc
cgcgatattacggcaacagtcgattctattccattgattacggcctctattctggccaaa
aaattggcggaagggctggatgcattggtcatggacgtgaaggtcggctccggtgccttt
atgccaacctactcgttgtcggctgatttggcgcaggcgattgttggtgtggcaaacggt
gcgggttgcaaaaccacggcgctactgacggacatgaaccaagtcctggcgtccagcgcc
ggtaatggggtcgaagtccgcgaagctgtgcgtttcctgacgggcgaatatcgcaaccca
cgtttgctggaagtgactatggcgctgtgtgttgaaatgttgctgtcaggcggtttagcg
cacgatgaagccgatgcccgtgccaagctgcaagccgttttggataatggcaaagcggcg
gaagtctttggccgtatggtggccgcgcaaaaaggcccggcagactttgttgaacgctat
gacagctacctgcccgttgctaccctaagcaaaccggtatttgctgaacagacgggaatc
attactgcaatggatacccgcgccttgggtatggcggtggtcgccctcggcgggggacgc
cgtcgggcaacggatcccattgattatagtgtagggctgacggagatggcccgtttgggt
acccgtgttgatgggcagcagccgcttgcggtgatccatgccaataacgaagatgactgg
cagcaggcggcagaggttgtgcgtgcggccatcaccttagggaataacacgccagaagaa
acgccagtgatttatcgccgtatcactgaataa

DBGET integrated database retrieval system