KEGG   Yersinia pestis Antiqua (biovar Antiqua): YPA_3847Help
Entry
YPA_3847          CDS       T00369                                 

Definition
hypothetical protein
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ypa  Yersinia pestis Antiqua (biovar Antiqua)
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ypa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    YPA_3847
Enzymes [BR:ypa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     YPA_3847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4333332..4333967)
Genome map
AA seq 211 aa AA seqDB search
MHSRLKACCVAISESACGRLSSHIPVKQGDALFLAQEIIRKKRDGQPLSEEEIRFFINGI
RDNVVSEGQIAALAMTIYFHDMSMPERVALTMAMRDSGTVLNWKSLNLNGPLVDKHSTGG
VGDVTSLMLGPMVAACGGYVPMISGRGLGHTGGTLDKLEAIPGFDIFPDDNAFRKIIMLV
WRLSAKPARWPLPISVFTRPAILRQQSILFH
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcacagtaggctgaaggcctgctgtgtcgctatttccgaaagcgcctgtgggcggctt
tcatcccatattccggtcaagcagggggatgccttgtttctggcacaagaaattatccgt
aaaaaacgcgacggtcagccattgagcgaagaagagattcgtttttttatcaatgggatc
cgcgataacgttgtttctgaagggcaaattgccgctttagcgatgaccatttatttccac
gacatgagcatgcctgagcgcgttgcgctgaccatggcgatgcgtgattccggtactgtg
ctgaattggaagagcctgaatctgaatggcccgctggtcgataagcactccactggtggc
gtgggtgatgtgacgtcactgatgcttggcccgatggtggcagcctgcggcggctatgtg
ccgatgatctctggccgtggtcttggtcataccggcggcacactggataaactggaggcg
atccccggttttgatattttcccggatgataatgcgttccgcaaaattattatgttggtg
tggcgattatcggccaaaccagctcgctggcccctgccgataagcgtttttacgcgaccc
gcgatattacggcaacagtcgattctattccattga

DBGET integrated database retrieval system